PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013906.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TCP
Protein Properties Length: 367aa    MW: 37884.3 Da    PI: 6.7213
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013906.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.91.8e-3477147373
          TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                  +++++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+++tg+++ +a + 
  Pbr013906.1  77 PARRSSKDRHTKVEGRGRRIRMPAVCAARIFQLTRELGHKSDGETIRWLLEHAEPAIIQATGSGTVPAIAI 147
                  57899**********************************************************66666322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.0E-2881148IPR005333Transcription factor, TCP
PROSITE profilePS5136926.60682136IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKSNQRQSLE ESNELEHGGD SNNTTTTTSV SGPLVADPPA TALTMKEELS DPVQHLDPQG  60
SLSMGIVPVP VSTALKPARR SSKDRHTKVE GRGRRIRMPA VCAARIFQLT RELGHKSDGE  120
TIRWLLEHAE PAIIQATGSG TVPAIAISVG GTLKIPTTSP ARPNGEITEI PNKRKKMRGS  180
TDEFIDAHDQ NSLPSGLAPI APMTYGGGGG GGGFVPMWQV GATGAAGPFF MFPNSGAIQN  240
QPHLWAIPTA DCTTPIFNFQ PRPMSNFVSA FQPGVQVGGV SGGDGQLQAS SGSISSGTAA  300
GGGGSCSSSL GHSLDSASGT SAAAAAAAPP SSATQMLRDF SLEIYDKKEL QFMGQAANAQ  360
TTYSES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr013906.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371263.10.0PREDICTED: transcription factor TCP19-like
RefseqXP_018506230.10.0PREDICTED: transcription factor TCP19-like
TrEMBLA0A498JN130.0A0A498JN13_MALDO; Uncharacterized protein
STRINGXP_009371263.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.24e-62TCP family protein