PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 846aa    MW: 94462.6 Da    PI: 5.4908
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013363.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.63.2e-19256305555
      G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +Wt+eLH +F  a++ L G +kA P++il+ m+v+++t+ +v+SHLQ+YR 
  Pbr013363.1 256 VWTTELHLKFTAAISAL-GDQKARPRRILKWMNVPDITVRQVASHLQRYRK 305
                  7****************.9*******************************5 PP

2Response_reg54.37.6e-19211281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vd + l ++   + lek  + +v++++ ++ al ++ke++  +Dl++  i+mp+ d + ll+ ++++e  +p+i+++++ + + a++al  Ga 
   Pbr013363.1  21 ILVVDHDTLSLMCTSSTLEKYSF-KVTTTALASVALSMIKEQKyhYDLVMANISMPDKDRFSLLRVLHKNE--IPVIFMSSEVNIDVAKKALAEGAC 114
                   89*********************.***************888888************************98..************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                    fl Kp++ e+l +
   Pbr013363.1 115 FFLQKPVSSEDLKN 128
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.69E-2417142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.3E-2518152No hitNo description
SMARTSM004484.9E-1619130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.97420134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-1521128IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.42E-1722133No hitNo description
Gene3DG3DSA:1.10.10.608.3E-19250309IPR009057Homeodomain-like
SuperFamilySSF466897.88E-14250307IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17252305IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MEDMSPKESN GLPSFAHGLQ ILVVDHDTLS LMCTSSTLEK YSFKVTTTAL ASVALSMIKE  60
QKYHYDLVMA NISMPDKDRF SLLRVLHKNE IPVIFMSSEV NIDVAKKALA EGACFFLQKP  120
VSSEDLKNVW QHAYRKVRNP RRDTHKTNCD KKKIHEVGVV LRPPTGGIRI HEVGGVSRLP  180
TGCDLCLDTQ DTHDKPQIAA ENYTQGALGI NRPVDDKEDQ EKAKKVKLNT QQDCDEEGME  240
NQDCDDSSKQ KKRHPVWTTE LHLKFTAAIS ALGDQKARPR RILKWMNVPD ITVRQVASHL  300
QRYRKIVHRI QEVGTTSLPS LGKSSIWNNR NEFPPARQTS LVCRLYEQGT SSSGAQGNPT  360
QLMTPNSFTG FNDYGRQNLY TEHRVMSHNT NYQSESLYDF YLRTQGKFEN LDQILETNSF  420
TLGADMNEIE RNQPLGLEEI MFKASERTLQ STNYMTPEFG SPYIPSNTFQ VPNASVSMNQ  480
AQNYCPAPTA PFNAQNQDHF SAEATRTAEV GMNQAQFYAP APTTSINSQN QNHFSAEATR  540
TAEVGMNQAQ FYAPAPTTSI NSQNQNHFSA EATRTTEVGM NQAQFYAPAT PINSQHQCHF  600
SAEATRTTQV GMNQAQYYAP APTTPINSQN QNHFSAEATR TTEVGMNQAQ FYAPAPTTPI  660
NSQNQNHFSA EATRTTEVGM NQAQFYAPAL TTPINSQNQN YFSADVMGTT EAGMNQPQYY  720
APAPTAPLYF QSQNHFSAEF TGTTDVLEVV PEQIPSVNAT NAETFPSNFT GGSQELDAAA  780
REAHPASSNN NQPMSEYDDL LKLLEEDPEK FNWFEPFDSA PNAGDANRYR EWLTETFLEM  840
SPDSL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr013363.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018502937.10.0PREDICTED: putative two-component response regulator ARR19
TrEMBLA0A498HIR00.0A0A498HIR0_MALDO; Uncharacterized protein
STRINGEMJ260481e-176(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144041618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-39response regulator 2