PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr012127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 671aa    MW: 72670.7 Da    PI: 6.0386
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr012127.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.3e-28232285155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G +kA+Pk+ile+m+v+gLt+e+v+SHLQk+Rl
  Pbr012127.1 232 KPRVVWSVELHQQFVTAVNQL-GLDKAVPKRILEMMNVPGLTRENVASHLQKFRL 285
                  79*******************.********************************8 PP

2Response_reg74.63.7e-25481561109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+ + +++l+ +l +  y +v+++++++ al+ll+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a g  + + + ++ Ga 
   Pbr012127.1  48 VLVVDDDTTCLRILELMLLRCLY-QVTTCSEATVALNLLRERKdcFDVVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADGRTSVVMRGIRHGAC 142
                   89*********************.***************99999***********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   dfl Kp+ ++el +
   Pbr012127.1 143 DFLIKPVREAELKN 156
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.3E-4045180No hitNo description
SuperFamilySSF521722.28E-3445167IPR011006CheY-like superfamily
SMARTSM004485.7E-2946158IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.2247162IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.9E-2248156IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.03E-2649161No hitNo description
SuperFamilySSF466891.4E-19229289IPR009057Homeodomain-like
PROSITE profilePS5129410.165229288IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-30229290IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-24232285IPR006447Myb domain, plants
PfamPF002491.9E-7234283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MAALQRVAQS SVSTTASSYG SCKGGGGVLS PSAAEMAVPD RFPAGLRVLV VDDDTTCLRI  60
LELMLLRCLY QVTTCSEATV ALNLLRERKD CFDVVLSDVH MPDMDGFKLL EHIGLEMDLP  120
VIMMSADGRT SVVMRGIRHG ACDFLIKPVR EAELKNIWQH VVRKKWNGSK ELEHSGSLED  180
NDPHKRGNND IEYTSSVNEG TEVSLKGQKK RINAKEDDDG DTENDDMSTS KKPRVVWSVE  240
LHQQFVTAVN QLGLDKAVPK RILEMMNVPG LTRENVASHL QKFRLYLKRL NGVAQQQSGI  300
ANAFCGPADS NGKLGSLSRF DFPALAASGQ IPPQTLAALQ AELLGQPAGN LMPATDQPAL  360
LHASLQGAKR PPVEHGVPFV QPFIKSQSNV SKQFPQPVIS AEDVSPGFGQ WRSNNRSTVA  420
PSNYHGGSSA LNSNLLMGVV QQEQRQHDRT QQQSALIEPC RSFNVQPSCL VVPSQSSTGF  480
QAGNSPASFN QSISFNKSTV IDYSLLSDQS NNSLNIGHIP TGNLKITGTL GGYSAPGSIS  540
PTSCIVNADN NSTSYQNSTA TFSDSRELPG VLHNTSNSQG FYVDKSGEML DQGPLRNLGF  600
VGKEACIPSR FAVDDFESQM SNLNPGRIQV ENSGALVKQE PIVDYVDNEK LGIPILQQYS  660
SSDFMSPFTD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-22228291164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr012127.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009351555.10.0PREDICTED: two-component response regulator ORR21 isoform X3
RefseqXP_018501945.10.0PREDICTED: two-component response regulator ORR21 isoform X3
SwissprotA2XE311e-158ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-158ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A498HFV30.0A0A498HFV3_MALDO; Uncharacterized protein
STRINGXP_009351555.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118082433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-112response regulator 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]