PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 671aa    MW: 73291.3 Da    PI: 6.2644
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011993.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.21.9e-28213266155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Pbr011993.1 213 KPRVVWSIELHQQFVGAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                  79*******************.********************************8 PP

2Response_reg75.91.5e-25351431109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+   y ev+ +  +e+al ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a + ++ + + +  Ga 
   Pbr011993.1  35 VLVVDDDPTCLMILERMLRTCLY-EVTKCNRAESALSLLRENKngYDIVISDVHMPDMDGFKLLEQVGLEM-DLPVIMMSADDGKSVVMKGVTHGAC 129
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   Pbr011993.1 130 DYLIKPVRIEALKN 143
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-18310661IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.4E-4232176No hitNo description
SuperFamilySSF521723.13E-3532156IPR011006CheY-like superfamily
SMARTSM004481.6E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.86834149IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.0E-2335143IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.30E-2736148No hitNo description
SuperFamilySSF466891.33E-19210270IPR009057Homeodomain-like
PROSITE profilePS512949.622210269IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-29212271IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-24213266IPR006447Myb domain, plants
PfamPF002491.9E-6215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MHLSNGMGSM STASSSGAWK SGDVVSDQFP AGLRVLVVDD DPTCLMILER MLRTCLYEVT  60
KCNRAESALS LLRENKNGYD IVISDVHMPD MDGFKLLEQV GLEMDLPVIM MSADDGKSVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KKKNEWKDVE QSGSVEEGDR QQKPSEDADY  180
SSSANEGSWK NSKRRKDEEE ETDERDDSST LKKPRVVWSI ELHQQFVGAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHQNN LSNPFMSPQE ASFGAMSSLN  300
GLDLQTLAVT GQLPAQSLAT LQAAGLGRST GKSGIPMPLV DQRNLFSFEN PKQQHMSGSK  360
PMNLLHGIPT TMEAKQLANL HQSAQTLGAV NMQVNAHGVQ NSSLLMPVPQ SQPRGQILNE  420
PSGNHVPRHS SSMGQPIISN GVCSGVLGRN GIVDSGRGIG YNQVHQNSLM LNYPLNNSSQ  480
LPGNNFTLGS TPVMSSLASK GAFLEDVTSD IKRSSGFMPS YDMFNELQQP KSNEWDLQNV  540
GLTFDPSQHT NSVHCSLDPS VLVHQGFSSS QRGGQSRNPS IVGKTMFSVG EGSHFGNMQN  600
TGQHLNGRIV DNTVRIKAEA VPDATSQTSF FHEQFGQDDL MSALLKQQDG LGPAENEFDF  660
DGYSLDNIPV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-22212272464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:11691951, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:19039136}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr011993.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by gibberellin. {ECO:0000269|PubMed:20605455}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN8232350.0FN823235.1 Malus x domestica genomic sequence for BAC clone MC-20 containing a Mal d 1 gene cluster.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369971.10.0PREDICTED: two-component response regulator ARR1-like isoform X2
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A498IDL50.0A0A498IDL5_MALDO; Two-component response regulator
STRINGXP_009369970.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
    In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system.
    Funct. Integr. Genomics, 2005. 5(3): p. 175-83
    [PMID:15714319]
  2. Moubayidin L, et al.
    Spatial coordination between stem cell activity and cell differentiation in the root meristem.
    Dev. Cell, 2013. 26(4): p. 405-15
    [PMID:23987513]
  3. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  4. Kurepa J,Li Y,Perry SE,Smalle JA
    Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype.
    BMC Plant Biol., 2014. 14: p. 28
    [PMID:24423196]
  5. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  6. Marín-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  7. D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
    The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem.
    J. Exp. Bot., 2015. 66(16): p. 5113-22
    [PMID:26163704]
  8. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  9. Moubayidin L, et al.
    A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
    Planta, 2016. 243(5): p. 1159-68
    [PMID:26848984]
  10. Muraro D, et al.
    A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana.
    J. Theor. Biol., 2016. 404: p. 182-205
    [PMID:27157127]
  11. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  12. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  13. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  14. Kushwah S,Laxmi A
    The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development.
    Plant Signal Behav, 2017. 12(5): p. e1312241
    [PMID:28467152]
  15. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  16. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  17. Liu B,De Storme N,Geelen D
    Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module.
    Cell Biol. Int., 2017. 41(8): p. 879-889
    [PMID:28618065]
  18. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  19. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  20. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  21. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]
  22. Waldie T,Leyser O
    Cytokinin Targets Auxin Transport to Promote Shoot Branching.
    Plant Physiol., 2018. 177(2): p. 803-818
    [PMID:29717021]