PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 367aa    MW: 41525.9 Da    PI: 6.8337
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011503.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.98e-39711711101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C+l pyfpa+qpk ++n+hklFG+sn+lk+lk+l++ ++ +am+s++y+A+ r + PvyG+ +vi++lq q+  ++++l++++
  Pbr011503.1  71 ACAACKYQRRKCTAECPLVPYFPADQPKMYQNAHKLFGVSNILKILKNLDPRQKVEAMRSIIYQANLRDKFPVYGCWEVIRQLQYQILAAEEQLQAVH 168
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  Pbr011503.1 169 QQL 171
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.41570171IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-3771168IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MLSIPPPPFL LPLLLLLQLT ATLLLLLFNF KHCTTLLSNC FRDFSRSRLS DWFRLRFGIR  60
KMPLKGATLQ ACAACKYQRR KCTAECPLVP YFPADQPKMY QNAHKLFGVS NILKILKNLD  120
PRQKVEAMRS IIYQANLRDK FPVYGCWEVI RQLQYQILAA EEQLQAVHQQ LAMYRQHHHH  180
QISSMPEYVM SQLELGMAPP NNALALFDYN LPPCILTNNN NATAVAPVNQ HQQQSYSNSS  240
SAAYNSDSKD NVNNNINNNN AGNPLWSSNP FMTNNSNNNN NDNNSEAIES ELGALQQLSI  300
QPGVVQDYNE LHPFFDTTDD RQSYIDSKEA YDSSSEESFK GTTQSMEHAE NALKYDAACF  360
SLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-267217412114LOB family transfactor Ramosa2.1
5ly0_B2e-267217412114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr011503.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369373.20.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A498JK570.0A0A498JK57_MALDO; Uncharacterized protein
STRINGXP_009369373.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-47LOB domain-containing protein 27