PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TCP
Protein Properties Length: 447aa    MW: 47895.9 Da    PI: 7.6694
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011454.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP578e-1892130240
          TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLG 40 
                  ++k+++++++hTkv+gR+RR+R++a+caar F+L+ eLG
  Pbr011454.1  92 PPKRTSTKDRHTKVDGRGRRIRMPALCAARGFQLTHELG 130
                  789***********************************9 PP

2TCP22.24.4e-0716624851114
          TCP  51 Llqqakpaikeltgtssssasec.eaesssssasnsssg.............................kaaksaakskksqksaasalnlakes 114
                  Llqqa+pa++++tgt++++a+++  + s +ss+s+ s +                             +           ++s+++ ln++ +s
  Pbr011454.1 166 LLQQAEPAVIAATGTGTIPANFTsLNISLRSSGSSMSVPsqlrssyyspnfslhqnqrrslfqgiglsS-----------SDSSSTLLNFQTNS 248
                  9*******************9998777777777755555555555666666666665333333333331...........33333334444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.3E-1396130IPR005333Transcription factor, TCP
PROSITE profilePS5136912.71698177IPR017887Transcription factor TCP subgroup
PfamPF036342.5E-9166260IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MEGGDDHQLH HHHHYQQHQQ QYHHRPNFPF QLLEKKELDH QEAASCSNST SPYPSLAITT  60
VDPTTNNNTS SPAATTTSAL QASSAEPSKK PPPKRTSTKD RHTKVDGRGR RIRMPALCAA  120
RGFQLTHELG XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXLLQQA EPAVIAATGT  180
GTIPANFTSL NISLRSSGSS MSVPSQLRSS YYSPNFSLHQ NQRRSLFQGI GLSSSDSSST  240
LLNFQTNSMH ASMLQAKQEL RDTVSLDLSE AASAGEGSMG GRKRRPPEQD LNQMGGGCGG  300
GGGGYLLQSS TGAVPASHPH SQIPANFWML ANSNNQVMSG DPIWTFPASV NNSGLYRGTM  360
PGGLHFMNFP APVTLLPSQQ QLGGSGGGGG SNDGNNMSDG QLNMLAGLNP YRHMSDTGVS  420
DSQQASGSHS HHGGGDDRHD STSHHS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr011454.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369315.10.0PREDICTED: transcription factor TCP14
TrEMBLM5WM860.0M5WM86_PRUPE; Uncharacterized protein
STRINGXP_009369315.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21203280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.14e-21TCP family protein