PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Nin-like
Protein Properties Length: 305aa    MW: 35032.7 Da    PI: 6.7778
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011436.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.97.1e-27147197252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  Pbr011436.1 147 SKMLSRETVSQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLNSL 197
                  68899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.962129217IPR003035RWP-RK domain
PfamPF020423.2E-22150197IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MWQACRSLLK RGYAALDWQF DLPIVQDHSF LDPLPLESCA DIDPIYSSLD IPPIRTVLED  60
DGIFFANETT WLGVNSSDLC AGLTEVNHNH HQQYQQQQQQ PLLLTCENEK KGITDEKDSR  120
EERNKVISKR PLSYKRHRSS SSSLSASKML SRETVSQYFY MPITQAAKEL NVGLTLLKKR  180
CRELGIRRWP HRKLNSLQTL IRNIQELGKE GEESSEKLRN AIALLERERK QLEEVPDMQL  240
EDNTKRLRQA CFKANYKKRK IMGMNVMGQS QSSLSCSNIQ YPTSSMDADE EDEEIKSLLS  300
DSFS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr011436.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369403.10.0PREDICTED: protein RKD2-like
TrEMBLA0A498I6E31e-115A0A498I6E3_MALDO; Uncharacterized protein
STRINGXP_009369403.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-44RWP-RK domain-containing protein