PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 170aa    MW: 18994.6 Da    PI: 6.2195
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010943.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.85e-4561051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+kdC++apyfp+++p+kf +vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la+++
  Pbr010943.1   6 PCASCKLLRRRCTKDCIFAPYFPSDDPHKFVIVHKVFGASNVSKMLQELPAHQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSELQMQLAVVQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Pbr010943.1 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0215106IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MPGTSPCASC KLLRRRCTKD CIFAPYFPSD DPHKFVIVHK VFGASNVSKM LQELPAHQRA  60
DAVSSLVYEA NARMRDPVYG CVGAISYLQN QVSELQMQLA VVQAEILCTQ MQHEPMVPTP  120
QQIMDDPDDQ KSYFLQNNNL GQYLSFPSSS NVIHDSLQRE NIFGHDMVS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369215.11e-125PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5X1C11e-102M5X1C1_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s19180.16e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-78LBD family protein