PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB_related
Protein Properties Length: 324aa    MW: 35470.9 Da    PI: 8.118
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010850.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding377.9e-1260104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W++ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Pbr010850.1  60 RESWSEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 104
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1554110IPR009057Homeodomain-like
PROSITE profilePS5129413.31555109IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-558110IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-1858107IPR006447Myb domain, plants
SMARTSM007172.0E-959107IPR001005SANT/Myb domain
PfamPF002491.4E-960104IPR001005SANT/Myb domain
CDDcd001672.84E-762105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVSKNPNPPE GLYLDPNDNG MPLPGLGPFA SVSATTSTTS SSAEDLSKKI RKPYTITKSR  60
ESWSEPEHDK FLEALQLFDR DWKKIEAFIG SKTVIQIRSH AQKYFLKVQK NGTSEHLPPP  120
RPKRKAAHPY PQKASKNALA LPPVSWSCQS SSALLESGFN QRPDSSSMLM SPIPGPVAPS  180
WPNGSVQTAN PSHESKVVSR PTVPNNSCST TESTPKAQPV GGTTDQVNHS HALRVLPDFT  240
QVYGFIGSVF DPNVTGHLQN LKKMDPIDVE TVLLLMRNLS MNLTNPEFED HRQLLSSYKM  300
DADTGNLSDA TKTLCDDQHE KVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr010850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744760.0DQ074476.1 Malus x domestica MYBR5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368733.10.0PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-117RVE6_ARATH; Protein REVEILLE 6
TrEMBLQ2LMD60.0Q2LMD6_MALDO; MYBR5
STRINGXP_009368733.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-99MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]