PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007941.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB_related
Protein Properties Length: 338aa    MW: 37111.1 Da    PI: 9.2818
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007941.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.8e-1382126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Pbr007941.2  82 RESWTDQEHDKFLEALQLFDRD-WKKIESFVG-SKTVIQIRSHAQKY 126
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-1776132IPR009057Homeodomain-like
PROSITE profilePS5129414.84777131IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-680132IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-1880129IPR006447Myb domain, plants
SMARTSM007178.6E-1181129IPR001005SANT/Myb domain
PfamPF002491.1E-1082126IPR001005SANT/Myb domain
CDDcd001674.67E-884127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVSVNPNPPQ GFYLFDPMNM GLPGLSSMPP PPPPTTGAAS ATAATSTTAA CTPSSATANA  60
ASMSADDQSK KIRKPYTITK SRESWTDQEH DKFLEALQLF DRDWKKIESF VGSKTVIQIR  120
SHAQKYFLKV QKKGTSEHVP PPRPKRKATH PYPQKAPKSA AVVSQIAGPF QSSSDLLEHR  180
YVYQPDSSFV LGTPVNAATL SSWSCNSVPP VNMSQTKDEG RLSGPTVTHN SCYSSSNESN  240
PINCKMRETV DGVGPGQPQR VLLVLTIVPV YAVLPDFAQV YKFIGSVFDP STTNHMERLR  300
QLDPINLETA FLLMRNLSIN LTRPEFEDHV SIHRLHF*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr007941.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366556.10.0PREDICTED: protein REVEILLE 3-like isoform X1
SwissprotC0SVG53e-93RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A498JEU20.0A0A498JEU2_MALDO; Uncharacterized protein
STRINGXP_009366556.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.29e-91MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]