PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Nin-like
Protein Properties Length: 331aa    MW: 37483.4 Da    PI: 6.5109
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007300.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.51e-26163213252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  Pbr007300.1 163 SKMLSRQTISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLTSL 213
                  57899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.076145234IPR003035RWP-RK domain
PfamPF020428.6E-22166213IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRGGGDGGE AHRRRVAMVE FAVAPSRGYA CDWQFDLPIV QDHRFPDPLP SLESCVNIDP  60
IYSSLDIPPI RTVLQDDEIF FGNGNALFGV NSNDLCGGLT EINHNHHQQF QQQQQPPLLL  120
TCKNDENGII DMNDSLEERD KAISERPHSS KRHRSSSSSL SSSKMLSRQT ISQYFYMPIT  180
QAAKELNVGL TLLKKRCREL GIRRWPHRKL TSLQTLIRNI QELGKEGEEG EEKLRNAIAL  240
LEMERKLLEE APDMQLEDNT KRLRQACFKA NYKKRKIMGT KVMEKSQSSF CCSNIQYPTS  300
SMDANEEDEE IKSLLSDSFS LNNNACITLF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr007300.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018499094.10.0PREDICTED: protein RKD2-like
TrEMBLA0A498I6E31e-143A0A498I6E3_MALDO; Uncharacterized protein
STRINGXP_008360907.11e-180(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.12e-43RWP-RK domain-containing protein