PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 500aa    MW: 54602 Da    PI: 8.5346
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007182.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.32e-42156231277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Pbr007182.1 156 CQVYGCNKDLSSYKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLGEFDDGKRSCRRRLAGHNERRRKPQ 231
                  **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.47153230IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.7E-33153217IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-39154233IPR004333Transcription factor, SBP-box
PfamPF031101.0E-31156229IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MESWSCISEG KGFVVSDGTI SHTDSLSRSR NGLMGWELKT PCTFMESQGF GELGFPEMVG  60
KHLQNDSIRD AVSTSMSTPN LFFGEDKSSS RISSSIVDSS SKDCSLIDLK LGRLADHRDV  120
HSSKLSKGTP MLSSSGSSTP PKRMRVLGVY PRPAYCQVYG CNKDLSSYKD YHKRHKVCEV  180
HSKTAKVIVN GIEQRFCQQC SRFHLLGEFD DGKRSCRRRL AGHNERRRKP QIGSHPGRAG  240
RFPQSFDGGR FEGNMLTTAS FICQEILPTD IPEKYGTGDW CRHVKVEGGT HYRPLSGMPV  300
TNGHLHSKPV FPSYDIGKQY PSFHENGTNP LTASIFSQNG SQYPQDVRGL SSGSHSIFHE  360
IALGSQDFNV FNTTSAVPGL SGISDSGCAR SLLSSRSQNS SSYSSGIPFA RPLVIPASRK  420
FPSSGMNSGA RSHLSPILLS NDCDDTNDFG ISDGIIQGSG FANTKDRLPC QDGATIDLLQ  480
LSSQLQQVED QRQSMQAKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291562291184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr007182.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337984.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_009337992.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A498KQW40.0A0A498KQW4_MALDO; Uncharacterized protein
STRINGXP_009337984.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-46SBP family protein