PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007163.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family bZIP
Protein Properties Length: 213aa    MW: 24349.9 Da    PI: 8.25
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007163.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.21e-1472123657
                  HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  + +r+++NRe+ArrsR RKk++ieeL+  v++L + N+ L ++l +l +  +
  Pbr007163.1  72 KLKRMISNRESARRSRMRKKKQIEELQYQVDQLHSTNRGLSDKLIQLLEGNQ 123
                  789**************************************99988876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-1464131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.26669118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-1269123No hitNo description
PfamPF001706.5E-1371129IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.63E-1271120No hitNo description
CDDcd147022.40E-1672120No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MEPNESKGTR YLPNHCLPNH PHPDSMPIYP PRFFPISHIH VPAHDFSPNA SSLSNEAAFD  60
EAGEPDMNYE RKLKRMISNR ESARRSRMRK KKQIEELQYQ VDQLHSTNRG LSDKLIQLLE  120
GNQLILQENA QLKERVSSLQ IVLADLITPL RNAGXXXXXX XXXXXXXXXG MPEKSLVTQV  180
AIDLEPKTQV RHDCLPPYYR EFRFASSSIG VQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr007163.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339530.11e-110PREDICTED: basic leucine zipper 43, partial
TrEMBLM5WVR42e-77M5WVR4_PRUPE; Uncharacterized protein
STRINGXP_009339530.11e-109(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.18e-33basic leucine-zipper 70