PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr005447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 586aa    MW: 64121.7 Da    PI: 6.6724
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr005447.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21119174156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  Pbr005447.1 119 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 174
                  688999***********************************************999 PP

2START1432.9e-453265091165
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ela++a++elvk+a+ +ep+W +s     e +n +e++++f++  +     + +ea+r+sg+v+ ++  lve+l+d++ +W e+++    + +t++vi
  Pbr005447.1 326 ELALAAMDELVKMAQTGEPLWLRSLeggrEVLNHEEYMRSFTPCIGlkpngFVSEASRESGMVIINSLILVETLMDSN-RWLEMFPgviaRTSTTDVI 422
                  5899************************99***********9999899**9***************************.******************* PP

                  CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
        START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                  ssg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd+ ++ ++ + ++ +++lpSg+++++++ng+s+ t
  Pbr005447.1 423 SSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDVIRDTSSAPTFMNCRRLPSGCVVQDMPNGYSRKT 509
                  **********************************************************99***********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-21103176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-22104170IPR009057Homeodomain-like
PROSITE profilePS5007118.058116176IPR001356Homeobox domain
SMARTSM003893.6E-19117180IPR001356Homeobox domain
PfamPF000465.2E-19119174IPR001356Homeobox domain
CDDcd000865.71E-20119176No hitNo description
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084830.362317507IPR002913START domain
SuperFamilySSF559612.75E-22319510No hitNo description
CDDcd088752.77E-95321509No hitNo description
SMARTSM002345.7E-26326544IPR002913START domain
PfamPF018522.3E-37326511IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MSFGGFLDNS TGSCGGTRIV ADIPYTNSNN NMPSSAIAQP HLVTQSLTKS MFNSPGLSLA  60
LQTNVDGEGD VTRVAESYEA NNGGRRSREE EHESRSGSDN MDGASGDDQD AADNNPRKKK  120
RYHRHTPQQI QELEALFKEC PHPDEKQRLE LSRRLNLETR QVKFWFQNRR TQMKTQLERH  180
ENSLLRQEND KLRAENMSIR DAMRNPICSN CGGPAIIGDI SLDEQHLRIE NARLKDELDR  240
VCALAGKFLG RPISSLATSM GPPLPSSTLE LGVGSNGFGG MSNVATSISM GPDFGGGIGS  300
AMSIVSHGRP SVTGLDRSIE RSMFLELALA AMDELVKMAQ TGEPLWLRSL EGGREVLNHE  360
EYMRSFTPCI GLKPNGFVSE ASRESGMVII NSLILVETLM DSNRWLEMFP GVIARTSTTD  420
VISSGMGGTR NGALQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSVDVIRDT  480
SSAPTFMNCR RLPSGCVVQD MPNGYSRKTN LLASTSHAST VGNHQVKVIH ARVMRAWMIN  540
SGTTQVHTFS YITCFTFIVL FPSGGVLLPL LFNESVEVTA TLGLC*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr005447.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0679610.0AF067961.1 Malus domestica homeodomain protein (h3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018501571.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLD9ZJ180.0D9ZJ18_MALDO; HD domain class transcription factor
STRINGXP_009349947.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]