PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TALE
Protein Properties Length: 144aa    MW: 16947.2 Da    PI: 9.6029
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001554.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.49.8e-08921252154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Pbr001554.1  92 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 125
                  469*****************************87 PP

2ELK26.91.1e-094667122
          ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                 ELK +L++++++++ ++++E++
  Pbr001554.1 46 ELKIELKQGFKSRIEDVREEIL 67
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.1324666IPR005539ELK domain
PROSITE profilePS5007111.67766129IPR001356Homeobox domain
SuperFamilySSF466898.55E-1768133IPR009057Homeodomain-like
SMARTSM003891.4E-1068133IPR001356Homeobox domain
CDDcd000861.86E-1069130No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2573131IPR009057Homeodomain-like
PfamPF059203.0E-1886125IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSDDEDDMQM DFPMDQSGAE GHDMMGFGPL LPTESERSLM ERVRQELKIE LKQGFKSRIE  60
DVREEILRKR RAGKLPGDTT TVLKNWWQQH SKWPYPTEDD KAKLVEETGL QLKQINNWFI  120
NQRKRNWHSN SQSVTSLKSK RKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A7e-1469125864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122142RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr001554.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0381321e-160JQ038132.1 Prunus persica cultivar Chiripa KNOPE7 (KNOPE7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373758.21e-103homeobox protein HD1-like
RefseqXP_009362836.11e-103PREDICTED: homeobox protein HD1-like
SwissprotP466062e-91HD1_BRANA; Homeobox protein HD1
TrEMBLA0A498JKP51e-101A0A498JKP5_MALDO; Uncharacterized protein
STRINGXP_009362836.11e-102(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.15e-93KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]