PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 1136aa    MW: 125890 Da    PI: 8.3586
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001211.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.3e-40148225178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCe+hsk+++ lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+qa
  Pbr001211.1 148 MCQVDNCKEDLSNAKDYHRRHKVCEIHSKSTKSLVAKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTQA 225
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33142210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.881146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-37147226IPR004333Transcription factor, SBP-box
PfamPF031103.2E-28149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1136 aa     Download sequence    Send to blast
MENAGGEVAA PIYFHQTLSG RFCDSPAMGR KRDHPYQGPN YQHPHLQQLR VTSPGNNWNP  60
NVWDWDAVRF VAKPLDSEMQ QLGTTFTTEQ RNKEEATGPV KNTAEDEHDE SLQLNLAGGF  120
TSVEEPVPRP NKRVRSGSPG NGNGSYPMCQ VDNCKEDLSN AKDYHRRHKV CEIHSKSTKS  180
LVAKQMQRFC QQCSRFHLLS EFDEGKRSCR RRLAGHNRRR RKTQAEDVTS RLTLPGGGDN  240
KSIGNIDIVN LLADIARPQG KNDVRNINGS SVLDREQLLQ ILSKINSLPL PADLAAKLPN  300
LGSLTRKASE LLSLDLQNKL NGRASTATMD LLTVLSATLA TSAPEALAML SQKCSQSSDS  360
EKTKLTCSDQ AAGPNLHKIP PQEIHSAGGE RSSTSYQSPM EDSDCQVQET RVNLPLQLFS  420
SSPENDSLPK LASSRKYFSS DSSNPTEDRS PSSSPPVVHT LFPMKSLAET VKSEKLLVSK  480
EVSANPDSSR TCGSNMPFDL FRGSNRGAEA TSIQSFPNQP GYTSSSSDHS PSSLNSDAQD  540
RTGRILFKLF DKDPSHLPGT LRTQIYNWLS NSPSEMESYI RPGCVVLSVY VSMPRASWEQ  600
LEENLVQHAR SLVQSSHSDF WRSGRFLVNT GRQLASHKDE KIRSCKAWRS CSSPELISVA  660
PLAVVGGQET SLLLRGRNLN TLGTRIHCTY MGGYTSKEAT GSAYHGMMFD EINLGSFQIH  720
DASPGVLGRC FIEVENGFRG NSFPVIIADA TICRELKVLE SVFEAESKVC DVISEDESHD  780
YGRPTSREEA LHFLNELGWL FQRKRICSML QEPHYALSRF KFLLTFSVEK DCCALVKTLL  840
DILFERNFDS DTLSGGSVML SDMQLLNRAV KRRCRKMVDL LINYSIVNSD IDKRYIFPPN  900
LAGPGSMTPL HLAACMSSTD DMIDALTNDP QEIGLNCWNS LLDASGQSPY AYALMRNNYS  960
YNNLVARKLA DRRNSQVTVT IGNERDQPQM SMELEHRTNT RSRQGSRSCT KCAIAATKYS  1020
RRVPGAQGLL QRPLIHSMLA IAAVCVCVCL FLRGSPDIGL VAPFKLALWS QWKREVFCLA  1080
AFKRKRRGVM ADLISKRILN QAQVFGDSDA GCLSPTNLRH VQSLGLLCSF VSRNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29141222384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1867872RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr001211.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362910.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A498HMP40.0A0A498HMP4_MALDO; Uncharacterized protein
STRINGXP_009362910.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]