PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GeBP
Protein Properties Length: 392aa    MW: 42595.9 Da    PI: 9.3238
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000214.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573117.48e-37166258197
       DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  klfqr+ws+eDe+++L+G++d+++k+g++p++d+ af++f+kks++++v+ksql  KirrLKkK+ ++vkk    k+ +++k+hdqk+f+lskk+Wg
  Pbr000214.1 166 KLFQRIWSDEDEVIILKGMVDYTTKKGADPYSDMGAFHDFIKKSLKVDVNKSQLQAKIRRLKKKYATNVKK----KKYNLTKAHDQKVFDLSKKVWG 258
                  579********************************************************************....8999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.6E-33168258IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSGG EEVSSEEEEG EEEESGSGSD SEPEEPLPPK TSSSAPVAEK  60
KPPPKKPDSS AANSKPQFSS SGSEDDSGSD VDKDLVVKPI ASKPMEETPK TKRPRSKPAA  120
TATPAAKSGS KRPSETEPKD SKRPKKKGAA VEQEPDQVEE EAKKSKLFQR IWSDEDEVII  180
LKGMVDYTTK KGADPYSDMG AFHDFIKKSL KVDVNKSQLQ AKIRRLKKKY ATNVKKKKYN  240
LTKAHDQKVF DLSKKVWGGS GEGSSGVNEP SEQPKSNGKA RNTKTLASIK ADILSSPERS  300
KEATKVDLGL NPCSSEGLSE VIGFDKCFRE LGLPEGVVKQ GLELIGESKR ADLKEKWRKL  360
HVAELELFVK RSELMRDQTK VILEALKSSG H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223236RRLKKKYATNVKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr000214.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366247.10.0PREDICTED: probable transcription factor At1g61730
TrEMBLA0A498IXL30.0A0A498IXL3_MALDO; Uncharacterized protein
STRINGXP_009366247.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.19e-31DNA-binding storekeeper protein-related transcriptional regulator