PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf16989g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 82aa    MW: 9409.15 Da    PI: 4.3217
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf16989g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB60.73.4e-191475197
                     NF-YB 51 sdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                              sdkc++e+r+t+ngdd++wal++lGf+ y+e++  yl k re+e+++
  Peaxi162Scf16989g00001.1  1 SDKCHKENRRTVNGDDICWALSSLGFDSYAEAMIRYLYKLREFERQR 47
                              89******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.8E-19173IPR009072Histone-fold
SuperFamilySSF471132.79E-15270IPR009072Histone-fold
PRINTSPR006159.5E-7422No hitNo description
PRINTSPR006159.5E-72341No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
SDKCHKENRR TVNGDDICWA LSSLGFDSYA EAMIRYLYKL REFERQRANQ SKGSFNDDED  60
TDDEATSESE KQETTLSPPA PL
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019233101.14e-43PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040279e-21NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A1J6KBZ11e-41A0A1J6KBZ1_NICAT; Nuclear transcription factor y subunit b-4
STRINGXP_009760265.12e-39(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.11e-22nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]