PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf02754g10013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TALE
Protein Properties Length: 687aa    MW: 77359 Da    PI: 6.9598
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf02754g10013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-084925232354
                               SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               ryps++++  L++++gL+++qV++WF N R +
  Peaxi162Scf02754g10013.1 492 RYPSEADKHLLSRQTGLSKNQVSNWFINARVR 523
                               7*****************************88 PP

2BELL88.47.9e-29299381172
                      BELL   1 erqelqkkkakLlsllee...........VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               e+ e q++k kLls+l+e           Vd rY +y+eq+q++++sF+ ++g+g+a pYt+lA+ka+SrhFrc+kdai+ q+
  Peaxi162Scf02754g10013.1 299 EKSEYQRRKIKLLSMLDEacnffilfsilVDARYTRYCEQMQAMVNSFDSMIGYGAASPYTALAQKAMSRHFRCIKDAIVAQL 381
                               57899************988888888888999************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-48230379IPR006563POX domain
PfamPF075262.8E-46235378IPR006563POX domain
Gene3DG3DSA:1.10.10.601.0E-4434457IPR009057Homeodomain-like
SMARTSM003892.0E-4463531IPR001356Homeobox domain
SuperFamilySSF466896.42E-12490534IPR009057Homeodomain-like
CDDcd000861.00E-8492528No hitNo description
PROSITE profilePS5007110.851492527IPR001356Homeobox domain
PfamPF059203.8E-12493523IPR008422Homeobox KN domain
Gene3DG3DSA:1.10.10.605.4E-17493533IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MLRVQGYESL PPPPPQQVEV EPPATVYDGG GMLTEIISYP SAWRKSATEM LDDQIQASYR  60
PWPQKEQQQQ LPPTINDVEL PLMNPHMKVS SPPRSSSSLH MLLPNSADTN SLLHHQGFHL  120
LNSATAEPPS QFTWVPGSGS GEDNSTRIGR VVDGQGLSLS LSRNFEAAAK LEDLRIGNGG  180
IYLQNNQGLL GINNNNHHQH QLLHSGVIMD HRTPQTSHQV HVGYAAAASP RITNVLRNSR  240
YVKATQELLE EFCCVGRGNF KNQRVKKCDD ENPNDSENNR DVGSSSSKDI NHPPLSAAEK  300
SEYQRRKIKL LSMLDEACNF FILFSILVDA RYTRYCEQMQ AMVNSFDSMI GYGAASPYTA  360
LAQKAMSRHF RCIKDAIVAQ LKQTCKFLGE KDVAGSSGLT KGETPRLKML DQKLRQQKAL  420
HQMGMLDSDA WRPQRGLPER SVNVLRAWLF EHFLHPYALH SLYFSFLLSF LLLFLLSLEQ  480
EIYLCHAGIV FRYPSEADKH LLSRQTGLSK NQVSNWFINA RVRLWKPMVE EMYQQETKEE  540
ETDQEEENHK EKQESAAQTP MHYDKTTSPT TTTIPLSSVR SEFNANERDT SKNIINYRQY  600
TLGNQQLVML PNQQLGQDDN SAASSTTHDV STTVNRYIMA DAVDLGVSNG TFGSQQAGDV  660
SLTLGLRHSE NVPRKTTQFQ LRDFGAY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773433.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_016504574.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-116BEL1-like homeodomain 2