PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01414g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family Dof
Protein Properties Length: 310aa    MW: 34242.5 Da    PI: 9.0133
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01414g00012.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.11.7e-373090262
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              +e+ ++cprC+stntkfCyynnyslsqPr++Ck+CrryWtkGGalr vP+Ggg+rknkk +
  Peaxi162Scf01414g00012.1 30 QEQVINCPRCNSTNTKFCYYNNYSLSQPRHYCKSCRRYWTKGGALRSVPIGGGCRKNKKIN 90
                              67899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-252488IPR003851Zinc finger, Dof-type
PfamPF027017.2E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8733488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTPDNKAEKS QSKEGDQSSS DRKTSTVRRQ EQVINCPRCN STNTKFCYYN NYSLSQPRHY  60
CKSCRRYWTK GGALRSVPIG GGCRKNKKIN SSSKDYSSAT SSSDIGGFNI FQGFSPAMDF  120
PKLNSSTTNS IFNKNSSFGG ISTSGSSPCF NLEHSAGSLM GFNLYLSKSL LKQVNDTGNL  180
ASSIESLSSI NQDLHWKLQQ QRLANMLFGG EDQKDSNVSS VPLGNIQKPQ PILFQNLENF  240
KPETAFGNNT SRKENSGSEN FATEWFFDNS FTSVNPTPTN SSNGNANENS NSWNDIQAWS  300
NLNQYSTVLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021274371.11e-113dof zinc finger protein DOF5.7-like
TrEMBLA0A061DI281e-111A0A061DI28_THECC; Dof-type zinc finger DNA-binding family protein
STRINGEOX918921e-112(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.19e-34Dof family protein