PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00987g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 287aa    MW: 32829.1 Da    PI: 6.5121
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00987g00110.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.5e-50101381129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrF P+deelv++yL kk++++++     + evd++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWka
  Peaxi162Scf00987g00110.1  10 LPPGFRFFPSDEELVCHYLYKKIANEEVLK-GSLVEVDLHTCEPWQLPEVAKLNSNEWYFFSFRDRKYATGFRTNRATTSGYWKA 93 
                               79************************9655.67***************88888999***************************** PP

                       NAM  86 tgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tgkd++v++  +g ++g++ktLvfyk+rap+g kt W+mhe+rle
  Peaxi162Scf00987g00110.1  94 TGKDRTVVDPrTGVVIGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                               ********9867888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-628156IPR003441NAC domain
PROSITE profilePS5100558.10810156IPR003441NAC domain
PfamPF023652.0E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFFPSD EELVCHYLYK KIANEEVLKG SLVEVDLHTC EPWQLPEVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV VDPRTGVVIG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKGKDG NNVSNNLRPE NMYETSVTSA  180
ELVVSPLNME NHATLPKLLP YADGYRPTAP AFFHSPTHHS QNSSNFQLSQ EINKVLANEM  240
AQSKYGKEDE FGFLYDMNFE DTGLQDGGLH SCLGDMKFED ENSLVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-4711561168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624737.11e-177PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A1S4BKT81e-175A0A1S4BKT8_TOBAC; NAC domain-containing protein 21/22-like
STRINGXP_009624737.11e-177(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.17e-94NAC domain containing protein 74