PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00942g00122.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CO-like
Protein Properties Length: 379aa    MW: 41586.8 Da    PI: 6.8149
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00942g00122.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.23.3e-0860105342
                  zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                ++C+ +e+  ++  C+ +   lC +C   +H+       H+++p+
  Peaxi162Scf00942g00122.1  60 VWMCEVCEQAAASVTCKADAAALCVTCDRDIHSAnplaqrHERIPV 105
                               689*******9*********************66899999998875 PP

2CCT69.96.6e-24305348144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Peaxi162Scf00942g00122.1 305 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 348
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.0721962IPR000315B-box-type zinc finger
SMARTSM003364.1E-41962IPR000315B-box-type zinc finger
CDDcd000212.50E-62362No hitNo description
PROSITE profilePS5011910.90758105IPR000315B-box-type zinc finger
PfamPF006432.7E-660105IPR000315B-box-type zinc finger
CDDcd000211.11E-761105No hitNo description
SMARTSM003361.6E-963105IPR000315B-box-type zinc finger
PfamPF062038.5E-18305347IPR010402CCT domain
PROSITE profilePS5101716.638305347IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGILRDGSNC FPGGWGAAAV AKLCECCRST AALVFCRTDN LFMCLGCDTR VHGGTRHERV  60
WMCEVCEQAA ASVTCKADAA ALCVTCDRDI HSANPLAQRH ERIPVVPFYD AVESVVKSTA  120
ATLLVSINNS NAMSTTTTPA TIPNCGGTIF DTSKVTTCLG HHEEYMTDPW ISTNTVTSKL  180
PVDFLFSESD NILDFDYPVS VDTHPQPHYN SANDSVVPVQ STTTNIKPLV VPFNHQEKHF  240
EIDFTQSHIK SFTTPSLSHS VSSSSLDVGV VPDGSSISEI SYPYGRSVEL GNSTSQGEKL  300
IGMDREARVL RYREKKKNRK FEKTIRYASR KAYAETRPRI KGRFAKRTDG AGVDSDIDHI  360
FSGNDFMAPD SRYGVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608073.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A1J6JVW20.0A0A1J6JVW2_NICAT; Zinc finger protein constans-like 5
STRINGXP_009608073.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-99CONSTANS-like 5