PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00940g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 309aa    MW: 36242.4 Da    PI: 9.494
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00940g00110.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-3275128255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               prlrWtp+LH++Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Peaxi162Scf00940g00110.1  75 PRLRWTPDLHRSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 128
                               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.75371131IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-3071129IPR009057Homeodomain-like
SuperFamilySSF466892.69E-1572129IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-2375130IPR006447Myb domain, plants
PfamPF002493.4E-876127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MEYITGKASS DSSSHRASSI DLNEDNKEET EEATEFSGEE CSEKKTEGNS EDNNISGDAH  60
VEKKNVRQYV RSKTPRLRWT PDLHRSFVHA IERLGGQERA TPKLVLQLMN VRGLSIAHVK  120
SHLQMYRSKK LDECGQVLGQ GYRAMQGRSY FYGDLRQRYN PLQDFKMKNG AIVLARNFDN  180
GDHVKGQFQK EFSRSQFHGN GIFSRMKSWQ SQERLSTPKQ FQEHKSNEIC SIRSSKFLEE  240
KRWPPREFIT NKWEEKRSQY LLHPNVQPYF KWNCRYNTVL EQNSGTSFRR EQPREEAEYL  300
RSDHAVAYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1776130357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1776130357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1776130357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1776130357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019246922.11e-116PREDICTED: uncharacterized protein LOC109226576 isoform X2
TrEMBLA0A1J6I9L81e-115A0A1J6I9L8_NICAT; Putative myb family transcription factor
STRINGXP_009802187.11e-115(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-36G2-like family protein