PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00939g00211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TCP
Protein Properties Length: 231aa    MW: 25346.9 Da    PI: 4.2744
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00939g00211.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP96.16.6e-30168229263
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikelt 63 
                                g+kdrhsk+ T +g+RdRRvRls++ a++f+dLqd+LG+d++sk++eWLl++a p+i el 
  Peaxi162Scf00939g00211.1 168 SGGKDRHSKVWTLKGLRDRRVRLSVNAAIQFYDLQDKLGYDQPSKAVEWLLKAAAPSISELL 229
                               689********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.6E-30169229IPR005333Transcription factor, TCP
PROSITE profilePS5136930.199170228IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSSLDTTMED EEYFFDSDTD AIIFGISDHS GWGGDSMISD PNIVSSPSTS IDDYQQQISM  60
AVGGGGDDDL MIASSAGASS SRLNNNNKQS EIRIFNVDFR ALSGVAVLSS QSCQSPQNNF  120
PQFCIQGDEQ NQDEEDSVRE IQNSTSVYDV TKLCGWPSSR IVRVSRASGG KDRHSKVWTL  180
KGLRDRRVRL SVNAAIQFYD LQDKLGYDQP SKAVEWLLKA AAPSISELLP L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A6e-21175228154Putative transcription factor PCF6
5zkt_B6e-21175228154Putative transcription factor PCF6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779111.11e-47PREDICTED: transcription factor TCP2-like
RefseqXP_009779112.11e-47PREDICTED: transcription factor TCP2-like
RefseqXP_016452455.11e-47PREDICTED: transcription factor TCP2-like
TrEMBLA0A1S3YK283e-46A0A1S3YK28_TOBAC; transcription factor TCP2-like
TrEMBLA0A1U7WGN23e-46A0A1U7WGN2_NICSY; transcription factor TCP2-like
STRINGXP_009779111.14e-47(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24642252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.27e-36TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2