PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00763g00212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YC
Protein Properties Length: 170aa    MW: 18038.1 Da    PI: 4.2518
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00763g00212.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC1276.9e-4017330102
                     NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                               +kadedv+misaeaP+l++kacelfilelt+rswlh+eenkrrtl+k+diaaa+trtdifdflvdivprdelk
  Peaxi162Scf00763g00212.1   1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHSEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDELK 73 
                               9*********************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.8E-13154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.68E-23169IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.6E-29169IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHSEEN KRRTLQKNDI AAAITRTDIF  60
DFLVDIVPRD ELKEEGGNVV GMLYNGPGMI GPGVHPYYYG PTTLGQPMIG RPVGGVVDPA  120
MYVQAPSQAW QSVWQGSEDD VSYATSGAGG GSGSSGGQGG NLDGQGSDGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B9e-421692795NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQKN
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022857127.13e-71nuclear transcription factor Y subunit C-1-like
RefseqXP_022857128.13e-71nuclear transcription factor Y subunit C-1-like
SwissprotQ9SMP04e-62NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A1S4AHJ93e-68A0A1S4AHJ9_TOBAC; nuclear transcription factor Y subunit C-1-like
STRINGXP_009618952.15e-69(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40872143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.14e-63nuclear factor Y, subunit C1
Publications ? help Back to Top
  1. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2015.
    [PMID:24831307]
  2. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2014. 9(7): p. e29109
    [PMID:25763489]
  3. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  4. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]