PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00740g00545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family SBP
Protein Properties Length: 502aa    MW: 54867.3 Da    PI: 7.7386
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00740g00545.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP74.42e-23165212249
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                               Cqv+gC +dls+ k+yh+rhkvCevhsk+++v+v+g+ qrfCqqCsr 
  Peaxi162Scf00740g00545.1 165 CQVQGCGKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIDQRFCQQCSRL 212
                               **********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-23161212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.743162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-22163214IPR004333Transcription factor, SBP-box
PfamPF031103.7E-18165212IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MESWSFVSGG SGFVSEESVS LDNGIERGRN GVISWELSTP CSFGSTVVNS SQEGIGNQEF  60
PELDTQNNHI RDVLVNKFGD GRVFSSVTAP HSAFSMESES TSKLSRSVVE SNCRDPSVID  120
LELGRFSDLK DAQSLISSKI VTSLTSNVPA KRMRAGGLNC HAPYCQVQGC GKDLSSSKDY  180
HKRHKVCEVH SKTAKVIVNG IDQRFCQQCS RLVIVFTTLS IVLCSRFRAN SFAMPSSLCQ  240
NVLGSSLLHQ PKYEMDWYKN VKVEDTADYS PSANGHSQPK SVFTSYHAEK QCPPLHDKGI  300
NALTRSKIDE ISKSYVHDMG RSDFVTRSLS TSIGGGEVLH VLDSTSTIQG LSGISNSSSA  360
HSLLSSQSQD SSNHSSLIPT AHHLITPSSN ARYNVTHISE KLLGVGQQTL STRVIDTFNS  420
TAVNSAETSL EQILVSHSSI DCSINRIIQG SEYINTKNKL PCADGLTIDL LQLSSQLHRV  480
EHQRSFMQLK QGINTRNTRA NR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-17165215656squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777336.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A2K9ZXH60.0A0A2K9ZXH6_PETHY; Squamosa promoter binding-like protein 6c
STRINGXP_009777325.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-27SBP family protein