PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00691g00048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 1165aa    MW: 131594 Da    PI: 5.7217
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00691g00048.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS267.44.8e-822135551347
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.. 83 
                               lv+lLl++Ae v ++++++ ++l++r   +as +g+p+qRl +yf++AL++r+ r + +  ++ + ++ +   +++ ++ +++  
  Peaxi162Scf00691g00048.1 213 LVHLLLAAAEEVGKQQFHQGSKLISRCMWTASDSGNPVQRLSFYFAKALQERIDRATGRYTNTDEDRHLKY--VKTMASGTNTef 295
                               68*****************************************************3333333333333332..222222222254 PP

                      GRAS  84 ..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerL 165
                                  +++ P+ ++ +++  q+I e v +++++H iD++i  G+QW  L+qaLa+   ++   l+iT+vgs   ++ke+ e+tg+ L
  Peaxi162Scf00691g00048.1 296 ftCHQLLPFSQVMQFAGVQTIIENVRSAKKIHLIDLNIRSGIQWTVLMQALAETGdSPIELLKITAVGS---TEKEKFEATGNTL 377
                               446799**********************************************876355569********...58*********** PP

                      GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                               ++fA++lg+pf+f+++  ++++d++ e+ +vk +E++aV +   l ++ +++ sl++    ++++v+s+ P+vvvv e ea+hns
  Peaxi162Scf00691g00048.1 378 HSFARSLGLPFSFDIVFLSDMKDFKQESVEVKADETVAVYCNCVLRTMISKPESLDN----LMRVVRSIGPTVVVVGEVEANHNS 458
                               *************************************************88888888....************************ PP

                      GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                               +sFl+rf+e+l +ysa+fd++e  +  +s  r+++E  ++g+ i+n+va+eg++r+ r  +le Wr+ + ++G+ + +lse+   
  Peaxi162Scf00691g00048.1 459 PSFLNRFIETLFFYSAFFDCFEDCMDGDSPCRTTIEGLYFGEGIRNIVAAEGKDRFTRSVKLEVWRAFFPRFGMVEEELSESSWY 543
                               ************************************************************************************* PP

                      GRAS 336 qaklllrkvksd 347
                               qa+l+l+++++d
  Peaxi162Scf00691g00048.1 544 QANLILKQFAQD 555
                               ********9965 PP

2GRAS305.11.7e-9379611631374
                      GRAS    1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaal 81  
                                lv+ Ll++Ae vs+++  +a++lL++ + las++g+p+qR+++yf+eAL +r+ r   e+ + +p s +++     s+  aa+
  Peaxi162Scf00691g00048.1  796 LVQILLAAAERVSNQQYDRARKLLSQCQALASNAGNPVQRAVFYFAEALGERIDR---ETGRLMPNSCSDKGIciASRFDAAF 875 
                                6899***************************************************...5555555554443335466666777 PP

                      GRAS   82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetge 163 
                                 ++++ +P+ ++ h+t  qaIle+v+++ +vH iDf i  G+QW++L+qa a+R+ ++  +++iT+++s   ++ke++ etg+
  Peaxi162Scf00691g00048.1  876 VAWHQEFPFTQVVHFTGIQAILESVATKPKVHLIDFLIRTGVQWASLIQAAAERKdNPIEHMKITVIES---VDKERVAETGK 955 
                                77****************************************************955566*********...79********* PP

                      GRAS  164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246 
                                 L++fA++l+ pf+f+++   + ++l++++L++kp+Ea++V+ ++ l  +  e+  le+     +++vk+l+P ++vv+e ea
  Peaxi162Scf00691g00048.1  956 SLTSFAKSLNFPFSFKIVFLPDKNQLTVNHLDIKPDEAIVVQAAFFLRAMICEPDVLEN----AMRVVKRLQPSLMVVSEVEA 1034
                                *****************9999******************************89888888....******************** PP

                      GRAS  247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329 
                                ++ns+ F++rf+++l yysa+fd+le  + r++++r+++E +  ++ i+n+v  eg+er+ r  +l  Wr+ + ++G+k+v+l
  Peaxi162Scf00691g00048.1 1035 NLNSPLFVNRFIDSLFYYSAFFDCLEDVMKRDNQNRMTLESVPYKEGIRNIVGSEGKERVSRSVNLDVWRSFFARFGMKEVKL 1117
                                *********************************************************************************** PP

                      GRAS  330 sekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                                se+   qa+l+++++  ++  + + + gsl   Wk+ p++svSaW+
  Peaxi162Scf00691g00048.1 1118 SETCLYQANLIIQQFTcKNSCSADVNGGSLAVSWKNTPIYSVSAWK 1163
                                ****************999999999********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.224187562IPR005202Transcription factor GRAS
PfamPF035141.7E-79213555IPR005202Transcription factor GRAS
PROSITE profilePS5098546.4277701142IPR005202Transcription factor GRAS
PfamPF035145.7E-917961163IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1165 aa     Download sequence    Send to blast
MDNVSISNDN LTDFQGVHFH PKGDERSELV ISGVEDPWLE LEDCEDIDSL YSMCDLSNQE  60
NTSNEQVRTN LLERLQQSIS DRPQSHFPTN TVMPLQPVQI QSTVEAPKHD EVPETGNSSS  120
EKPNPFSSAS LELLNNYGRL IKKSSVENLS NALSYKTCVG KSHKLSMEEI LIAAGERYIQ  180
YSTQRLDGLS MFIHPYGSAL SGLSMEETRD MELVHLLLAA AEEVGKQQFH QGSKLISRCM  240
WTASDSGNPV QRLSFYFAKA LQERIDRATG RYTNTDEDRH LKYVKTMASG TNTEFFTCHQ  300
LLPFSQVMQF AGVQTIIENV RSAKKIHLID LNIRSGIQWT VLMQALAETG DSPIELLKIT  360
AVGSTEKEKF EATGNTLHSF ARSLGLPFSF DIVFLSDMKD FKQESVEVKA DETVAVYCNC  420
VLRTMISKPE SLDNLMRVVR SIGPTVVVVG EVEANHNSPS FLNRFIETLF FYSAFFDCFE  480
DCMDGDSPCR TTIEGLYFGE GIRNIVAAEG KDRFTRSVKL EVWRAFFPRF GMVEEELSES  540
SWYQANLILK QFAQDCTTNR LDSVGGSSHT KNERTGLIYL IFIPLSAIHV QIRRCLQITL  600
SSDMANPLFH LASFTSDQIS GSDGSLRRCK EDIAKSYDQL SSVLKDSTDI QNFCTNYGFY  660
QEYAVNPQVQ EMNKQQEEMN VYASHSAGQL TQEKMKLHGL ETGKDMEKAP FLSLAPFELL  720
RNHPSRCKYI EGDKIRNMKD GTNMYQKLSA MQIMRLAGER FIQFSSHKFI NINNLLHPYG  780
SALSDLSPED NQDVELVQIL LAAAERVSNQ QYDRARKLLS QCQALASNAG NPVQRAVFYF  840
AEALGERIDR ETGRLMPNSC SDKGICIASR FDAAFVAWHQ EFPFTQVVHF TGIQAILESV  900
ATKPKVHLID FLIRTGVQWA SLIQAAAERK DNPIEHMKIT VIESVDKERV AETGKSLTSF  960
AKSLNFPFSF KIVFLPDKNQ LTVNHLDIKP DEAIVVQAAF FLRAMICEPD VLENAMRVVK  1020
RLQPSLMVVS EVEANLNSPL FVNRFIDSLF YYSAFFDCLE DVMKRDNQNR MTLESVPYKE  1080
GIRNIVGSEG KERVSRSVNL DVWRSFFARF GMKEVKLSET CLYQANLIIQ QFTCKNSCSA  1140
DVNGGSLAVS WKNTPIYSVS AWKFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-47243116326375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016493163.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S4BWE80.0A0A1S4BWE8_TOBAC; DELLA protein RGL1-like
STRINGXP_009797878.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.19e-55RGA-like 1