PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00624g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 276aa    MW: 31681.9 Da    PI: 5.4027
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00624g00014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.5e-50101381129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrF P+deelv++yL kk+++++++   ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWka
  Peaxi162Scf00624g00014.1  10 LPPGFRFYPSDEELVCHYLFKKIANEDVHS-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATISGYWKA 93 
                               79*************************999.88***************87788899***************************** PP

                       NAM  86 tgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tgkd++vl+  +++ vg++ktLvfyk+rap+g kt W+mhe+rle
  Peaxi162Scf00624g00014.1  94 TGKDRTVLDPqTRAIVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                               *********856667***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-598156IPR003441NAC domain
PROSITE profilePS5100556.9210156IPR003441NAC domain
PfamPF023656.5E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEDVHSG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV LDPQTRAIVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP LIPPKEDWVL CRVFDKAKCE NISSSNILSP QILYEAADLA  180
ISPPSIDHHA LSYGGYRPTP ATAVLSRNFF DVLESQDNQR NYLQLSQEMN KAPLNVMAED  240
DEYRFLLDMN NFEVPSLQDV GPGNIRFEDD NSLVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-48915616165NO APICAL MERISTEM PROTEIN
1ut4_B9e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_A9e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_B9e-48915616165NO APICAL MERISTEM PROTEIN
4dul_A9e-48915616165NAC domain-containing protein 19
4dul_B9e-48915616165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800923.11e-149PREDICTED: NAC domain-containing protein 21/22-like
RefseqXP_016469611.11e-149PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A1S3ZZ691e-148A0A1S3ZZ69_TOBAC; NAC domain-containing protein 21/22-like
TrEMBLA0A1U7YCR11e-148A0A1U7YCR1_NICSY; NAC domain-containing protein 21/22-like
STRINGXP_009800923.11e-149(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-93NAC domain containing protein 74