PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00569g00114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 204aa    MW: 23352 Da    PI: 7.1238
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00569g00114.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.43.5e-3354108358
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                               k +YkeClkNhA+ +GghavDGCgEfmp+ ge+g+ ++lkCaAC+CHRnFHR+ ++
  Peaxi162Scf00569g00114.1  54 KPKYKECLKNHAVGIGGHAVDGCGEFMPA-GEDGSLDSLKCAACNCHRNFHRKVPT 108
                               679*************************9.999********************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015664.6E-3156105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-2156105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.2E-3056106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.82257106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.7E-16157203IPR009057Homeodomain-like
SuperFamilySSF466892.33E-7162202IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MDQFEDQEDQ KQVEEIQPSH DSLNNTNSTQ PKMPSPPHPQ QQQQLVQYNT WNNKPKYKEC  60
LKNHAVGIGG HAVDGCGEFM PAGEDGSLDS LKCAACNCHR NFHRKVPTTP PAEHFVYHPS  120
YYRTLPPPCG YLHHVAPQQR PLALPSTSGG GGYREDLEDM SNPRWRIQRE DEELVQQFCN  180
ETGVRRQVFK VWMHNNKHTL GKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-121651994175ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-32HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769511.17e-95PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
RefseqXP_016472938.17e-95PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotA2Z2591e-50ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH51e-50ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1C6692e-88M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606235e-88(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-51homeobox protein 22