PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00525g00067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 231aa    MW: 26018.7 Da    PI: 6.9465
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00525g00067.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.71.6e-5355150297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easd+cq ekrktingdd+++al+ lGf+dyv+plk+y
  Peaxi162Scf00525g00067.1  55 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDRCQTEKRKTINGDDIIYALTILGFDDYVAPLKTY 139
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l kyrelegek
  Peaxi162Scf00525g00067.1 140 LLKYRELEGEK 150
                               ********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5248170IPR009072Histone-fold
SuperFamilySSF471133.57E-3957168IPR009072Histone-fold
PfamPF008083.5E-2760124IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-1788106No hitNo description
PROSITE patternPS00685091107IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.0E-17107125No hitNo description
PRINTSPR006154.0E-17126144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEDERQGNGP NVTIKSSPES TSRITPITTS TFTTNSSNVK NNNNNNNNNK STSTKEQDRF  60
LPIANVGRIM KKVIPGNGKI SKDAKETVQE CVSEFISFVT GEASDRCQTE KRKTINGDDI  120
IYALTILGFD DYVAPLKTYL LKYRELEGEK LNVPKQQQQQ QQHQQQQQQQ LVQLHDHTSN  180
MPSYNNVYSP TGLLPQASFL STDQSFSLPF SQNSTQSQLT KQEQIDSVGH W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4453145193NF-YB
4awl_B2e-4453145294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4453145294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552944.11e-101PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotQ9SIT93e-63NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A1U8F9N01e-99A0A1U8F9N0_CAPAN; nuclear transcription factor Y subunit B-3-like
TrEMBLA0A2G2UZ411e-99A0A2G2UZ41_CAPBA; Nuclear transcription factor Y subunit B-7
STRINGPGSC0003DMT4000431763e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.16e-63nuclear factor Y, subunit B7
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]