PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00524g00082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family Dof
Protein Properties Length: 267aa    MW: 30016.7 Da    PI: 7.1223
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00524g00082.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1071e-333996360
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                               + l+cprC s ntkfCyynny+ sqPr++Ck+C+r+Wt+GG+lrn+PvGggr+++++
  Peaxi162Scf00524g00082.1 39 PEPLNCPRCGSINTKFCYYNNYNKSQPRHYCKGCKRHWTAGGTLRNIPVGGGRKNKRT 96
                              6789***********************************************9776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.0E-304195IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-214295IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7394296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGLSTKLVSI DDHGLDSCQN SLQELPKPPP IRKQPPSKPE PLNCPRCGSI NTKFCYYNNY  60
NKSQPRHYCK GCKRHWTAGG TLRNIPVGGG RKNKRTRPTD HSVDHITGRK YVTLEVNDRR  120
CPLITTTITT PTTSNVSSYT IRGNSIIDEG KKEYDIFYET LNIASSSLPL DHTHFSFSSI  180
GPVPCSVPDY VQSSNAYEYM GKFDGTMEES TITTVMPITS SLSQSWQVQE TSNLVENMPS  240
TYWNWNEIDT LSAADLNIPW DDLEIKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624330.11e-118PREDICTED: uncharacterized protein LOC104115407
TrEMBLK4B9861e-102K4B986_SOLLC; Uncharacterized protein
STRINGSolyc02g078620.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-26OBF binding protein 4