PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00426g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family SBP
Protein Properties Length: 512aa    MW: 56128.9 Da    PI: 9.0114
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00426g00007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.2e-42152227277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC  dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  Peaxi162Scf00426g00007.1 152 CQVQGCGRDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 227
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-33148213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-38151230IPR004333Transcription factor, SBP-box
PfamPF031101.6E-32152225IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MESWSYFSGG KGFISEESVN LNDGRVKNGV MGWELKTQSS YGSTVMCSSQ ESDNNQVYPE  60
LGSQNLLRKG MLNDQIRDNL TSKLGGSSIF SSSPAVESNC RDSSLFDLKL GRFPDHIDAK  120
VFKSPKILPS FTSAESIVPA KRMRAGGVSS FCQVQGCGRD LSSSKDYHKR HKVCEVHSKT  180
AKVIVNGIEQ RFCQQCSRFH LLAEFDDGKR SCRKRLAGHN ERRRKPHTGT RFRGTSFATS  240
SFICQDILGS RILHQPKYEM NDWYKNVKVE DGVDYSPQLT MPFTNGQLQP KSVFTSYQAK  300
KQCPPLHNEG LPSLTGRKIN ESTNTSPHEM GGSDFVSPSL FRTTSIGTEV LHVLDTSSNI  360
QGLSGISSSS NALSLLSSQS QDSSNHSTII PVAHPLIPPS SNSHYNVTQV SKKVIQVSPQ  420
ASASSLSNTF NPSGVNSAEG GLEQILIPSN TSGINGVIQG QNCVNTKNQL SCEDGPTINL  480
FQLSSQLQRV EHQRLSMQMK QDNSAFPGLR IT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-301512251084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019230968.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2K9ZXI20.0A0A2K9ZXI2_PETHY; Squamosa promoter binding-like protein 6d
STRINGXP_009758722.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-44SBP family protein