PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00367g00082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TCP
Protein Properties Length: 383aa    MW: 43907.6 Da    PI: 6.7961
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00367g00082.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP131.11e-401182492136
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                               +gkkdrhski+T++g RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ +++ aikel  + s+ +++c+++ss+ ++ ++s
  Peaxi162Scf00367g00082.1 118 TGKKDRHSKICTAQGVRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSNNAIKELLANISQENNSCNSNSSNDQGRKES 202
                               79**************************************************************999999995555555544222 PP

                       TCP  87 sgkaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                               +  + +s+ +++k++ + + ++n  k ++    a+  e+++ekm+ik ++
  Peaxi162Scf00367g00082.1 203 K-FEVPSSLEKSKNEVKVKDHRNSRKMES--IGAKGMESNKEKMMIKRHK 249
                               2.233333333344444444444444333..3344558899999998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.9E-38118242IPR005333Transcription factor, TCP
PROSITE profilePS5136936.564120178IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MFPKSNINDL FPYNEDELLK QSFTYDYHQN PNSTSRVELD HPFFSHFPSP FLDVQEYPLS  60
QIFSQELDAS HDHDIEADLD ISGSMEDQSS NPGKEIPPEP ASPSSKKRKL SAKPRRRTGK  120
KDRHSKICTA QGVRDRRMRL SLQIARKFFD LQDMLGFDKA SKTIEWLFSK SNNAIKELLA  180
NISQENNSCN SNSSNDQGRK ESKFEVPSSL EKSKNEVKVK DHRNSRKMES IGAKGMESNK  240
EKMMIKRHKK GKELYQITNP NNVESNIFCN KDTTQEKSTS PHEANSQTLE HQFANVGIME  300
SYLGGTSSSL TSIFDNHENN IEVRGRDNYD NCFMSYLENW DIKNTSSSSY CSTTMTNEIQ  360
IPFAGNLSSI YLDNSRFQFQ HLD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106116KRKLSAKPRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0021040.0KR002104.1 Petunia x hybrida TCP transcription factor 2 (TCP2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016450579.11e-140PREDICTED: transcription factor TCP12-like
TrEMBLA0A0H4UQT60.0A0A0H4UQT6_PETHY; TCP transcription factor 2
STRINGXP_009601065.11e-139(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24362359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.12e-31TCP domain protein 12