PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00366g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 312aa    MW: 35249.1 Da    PI: 8.5076
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00366g00031.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.37.8e-33103159360
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                               +vrY+eClkNhAa++Ggh++DGCgEfmps geegta+ lkCaAC+CHRnFHR+e+e+e
  Peaxi162Scf00366g00031.1 103 SVRYRECLKNHAATMGGHVLDGCGEFMPS-GEEGTAEYLKCAACDCHRNFHRKETEDE 159
                               69**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-21103157IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-30104156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.6E-30105155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.401106155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.55E-17241309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27245310IPR009057Homeodomain-like
TIGRFAMsTIGR015651.2E-25248305IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEHRSQEKDM GMPNSLGYNP SHLNNQESSS SAASKVPTVP ILSSILDGKT NEQVGHGNTI  60
ISPNQTLEHQ RNLIQNSDLD PHTTVQIRQQ SSTTSASDHR TISVRYRECL KNHAATMGGH  120
VLDGCGEFMP SGEEGTAEYL KCAACDCHRN FHRKETEDES QTPGVRRNNS INNNHHIHTQ  180
PPPSLQHPPL QHHHNKYSHN YSRGPTPSVM MNFGGNTGIP AESSSEDLNM FHTNAGGQGV  240
MQPCNFSKKR FRTKFTQQQK DRMQEFAEKL GWRIQKQDEQ EVQQFCNEVG VKRQVFKVFM  300
HNSKQAIKRK QT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-212493041873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-51HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603276.11e-179PREDICTED: zinc-finger homeodomain protein 6-like
RefseqXP_016451406.11e-179PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW72e-67ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH11e-152M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090331e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-65homeobox protein 24