PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00300g00828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRF
Protein Properties Length: 521aa    MW: 57762.6 Da    PI: 6.6908
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00300g00828.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.61e-23177219244
                       WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  Peaxi162Scf00300g00828.1 177 LEPGRCKRTDGKKWRCSRDVAPFQKYCERHMHRGRPRSRKHVE 219
                               69***************************************98 PP

2QLQ50.75.6e-18117149234
                       QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                               +FT+aQ+ +L++Q+++yKy+++  PvP++Llq+
  Peaxi162Scf00300g00828.1 117 PFTWAQWKELERQAMIYKYMVSAIPVPQDLLQF 149
                               8******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-8116152IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.316117152IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-13117148IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.005176220IPR014977WRC domain
PfamPF088791.1E-19178219IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
KAKFATTTES FPYKIMMGHT YHHQDPHRPF SAGDDDRGGG DGDPTPNHSG VNKMACSSEH  60
NVYPATCGVR TLQPFDISTE SKLSEKLWEK VCVFWIINVL FVCGNFAGGM TTALGLPFTW  120
AQWKELERQA MIYKYMVSAI PVPQDLLQFC INSSGASHTT LSSGLVQGQR YTNVRDLEPG  180
RCKRTDGKKW RCSRDVAPFQ KYCERHMHRG RPRSRKHVEV HANENNKKTR IHPESTPMAV  240
PKPPTPTGQT KSTSSSTQPI RSTFQQMQGP LFFNGKMRNS GWTMERELVA KADVGQHLMD  300
SNTDFSADVK VHPDLQHGYK VEALNLLACR GLERTEDVSI KHNGEFNFMI NPELVKQSVE  360
EAPRDLINAW SNDEVYYNSN NENMEASLWP SQGNISPSSL TLSMAMAAGD ALDADMGLES  420
NVAMNGYRNE SWENYWVPFA SGGPLAEVLH PNTSSIQGEN PATSYISNDD SISPAATTVS  480
SPSGVLQKTM FSHSDGSVCN SPILAPPTTN TSETVPFQWL S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754423e-50HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597554.10.0PREDICTED: growth-regulating factor 7-like isoform X1
RefseqXP_009597555.10.0PREDICTED: growth-regulating factor 7-like isoform X2
TrEMBLA0A1J6ISR10.0A0A1J6ISR1_NICAT; Growth-regulating factor 7
STRINGXP_009597554.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.19e-35growth-regulating factor 7