PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00228g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 537aa    MW: 60210.9 Da    PI: 5.5458
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00228g00110.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS29.21.1e-093895142203
                      GRAS 142 lRiTgvgspesgskeeleetgerLakfA.eelgvpfefnvlvakrledleleeLrvkpgEala 203
                               + iT+vg     sk+++ee+g+rL++fA e+++vpf+f++ v++++++l+ + ++++ +E++a
  Peaxi162Scf00228g00110.1  38 FLITAVGT----SKQMVEEIGQRLSSFAaENMKVPFSFKA-VVSDMKNLNKDIFELDANEVVA 95 
                               569*****....9**************73679********.7999****************98 PP

2GRAS263.57.4e-811655334374
                      GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalkl... 83 
                               lLl  Ae+++ +++ +a++lL+   + + ++g+p+qR++ yf+eAL +r++r ++++ +++  ++++ s+++++e+l+  ++   
  Peaxi162Scf00228g00110.1 165 LLLVSAEMLAIQQFDRARKLLNICINCSFSTGNPIQRAVYYFAEALIKRINR-GTGIPSTItaNVNAVSPDDMEEVLMDPRIdvi 248
                               788899*********************************************9.66666666335566666778888888877878 PP

                      GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLa 166
                                  ++ P+ k++++t  qaIle++++ +r+H iD++i+ G QW  L+qaL s+ e p   l+iT+vg     s  +++e+g+rL+
  Peaxi162Scf00228g00110.1 249 eTEQMLPFRKVTQFTGIQAILESIKSFRRIHLIDLGIKTGSQWTILMQALVSQGECPLeLLKITAVGT----SLIRIQEIGKRLS 329
                               899************************************************998555449********....9************ PP

                      GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                               +fAe+l++pf+f + v+++l +++   +++k gE+la+    +  +l + + +l+s    +++++ksl P v+vv+e ea +n++
  Peaxi162Scf00228g00110.1 330 SFAETLNIPFSFGT-VVSDLRNIKKAFFELKAGEVLAIYADSRFWTLIAWPNDLKS----LIQVIKSLDPCVMVVTEIEAYTNAP 409
                               **************.7999*****************************88888888....************************* PP

                      GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                                F +rf eal yysa+fd+le+ ++ ++++r++   ++lg+ i+nv++ eg+e ++rh +l  Wr+ +e++G+++ +ls++   q
  Peaxi162Scf00228g00110.1 410 IFIDRFNEALFYYSAIFDCLETCIGWNHQQRAVAQGVYLGKIIENVITSEGEEMVHRHVKLDCWRALFEKSGLEETELSHSSLYQ 494
                               ************************************************************************************* PP

                      GRAS 337 aklllrkvksdgy.rveeesgslvlgWkdrpLvsvSaWr 374
                               akll ++    g+ ++e + +sl++ Wk+ p+ s+S+W+
  Peaxi162Scf00228g00110.1 495 AKLLAERSTCPGFcSLEMDGKSLIIKWKGTPIKSLSVWK 533
                               *********999637889999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.9E-73895IPR005202Transcription factor GRAS
PROSITE profilePS5098541.311136512IPR005202Transcription factor GRAS
PfamPF035142.6E-78165533IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSSQQAGFIW LILESKVGRT GQSSWKPLLI ELIVHLSFLI TAVGTSKQMV EEIGQRLSSF  60
AAENMKVPFS FKAVVSDMKN LNKDIFELDA NEVVAGKVNE MNLDMPSDVS GSPVLSTTTI  120
MNIARDQLFH YTSQKYDAYS IIFSPLISDL GLSPQVTEEV ELALLLLVSA EMLAIQQFDR  180
ARKLLNICIN CSFSTGNPIQ RAVYYFAEAL IKRINRGTGI PSTITANVNA VSPDDMEEVL  240
MDPRIDVIET EQMLPFRKVT QFTGIQAILE SIKSFRRIHL IDLGIKTGSQ WTILMQALVS  300
QGECPLELLK ITAVGTSLIR IQEIGKRLSS FAETLNIPFS FGTVVSDLRN IKKAFFELKA  360
GEVLAIYADS RFWTLIAWPN DLKSLIQVIK SLDPCVMVVT EIEAYTNAPI FIDRFNEALF  420
YYSAIFDCLE TCIGWNHQQR AVAQGVYLGK IIENVITSEG EEMVHRHVKL DCWRALFEKS  480
GLEETELSHS SLYQAKLLAE RSTCPGFCSL EMDGKSLIIK WKGTPIKSLS VWKFHNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3719553336375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358212.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLK4AWA30.0K4AWA3_SOLLC; Uncharacterized protein
STRINGSolyc01g059960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-53RGA-like 2