PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00228g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 484aa    MW: 54347.4 Da    PI: 4.9236
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00228g00007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS243.49.1e-751174804374
                      GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fse 86 
                               +L + Ae+  +++  +a++ L+     as +g+p+qR++ yf+eAL+ ++ +  +++  a  ++  +  +++++l+ +     ++
  Peaxi162Scf00228g00007.1 117 QLHASAEFYVQKQYGKARKWLSLCYPSASVTGNPVQRVVYYFAEALRDKIDK-ETGTTPAEGSKMLKGVDVEDALMLVPSarCQQ 200
                               688889999999999************************************9.333333333444444456666666655789** PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAe 170
                               + P+ k++++   qa+l+ v +++r+H iD++i+ Gl +p +++aLa+R+e p   l+iT+vg     s++++eetg+ L++fAe
  Peaxi162Scf00228g00007.1 201 AVPFSKIAQFPGMQAVLDNVMSAKRIHLIDLGIQSGLPFPIIMNALANRNECPVeLLKITAVGT----SRQRIEETGKMLSSFAE 281
                               **************************************************7665499*******....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               ++++pf f++ v+ +l+dl+ e++++++gE++aV + ++l ++l+ + +le     ++++++sl+P v+vv+e ea++n++sF++
  Peaxi162Scf00228g00007.1 282 QMNIPFLFSM-VVLELKDLRKENIELEEGEVVAVYSEFRLWTMLAWPNHLEG----LVRVINSLKPSVMVVSEVEASTNTPSFMN 361
                               **********.7999*****************************77777777....***************************** PP

                      GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                               rf   l+y+sa fd+l + + +++++r+  E  +l++ i++v+  eg++r+ +h + + Wre + ++G  + ++s +   qa+ll
  Peaxi162Scf00228g00007.1 362 RFDALLSYCSATFDCLGTCMKPDDKNRAIAEGIFLREMIQSVIIVEGEDRI-QHARISFWREYFARFGIVETEFSASSLYQADLL 445
                               *************************************************66.5778***************************** PP

                      GRAS 341 lrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               ++ ++ ++  ++e + ++l+  Wk+ p+ s+SaW+
  Peaxi162Scf00228g00007.1 446 IQSTAcWKSCSWEFDGKCLITKWKGTPVNSLSAWK 480
                               *****9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.57188459IPR005202Transcription factor GRAS
PfamPF035143.2E-72117480IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MDSFSEDQAT KEVNDQPQIP DVAEEKMENS CPLSAPIFTL LQKFDSHFRH LSAEKLNEKV  60
SDTPCSSIEL PSTDEIMKMA RAKLVQHTST NSSIYSIFLI PSGLPPEIAD DVELALQLHA  120
SAEFYVQKQY GKARKWLSLC YPSASVTGNP VQRVVYYFAE ALRDKIDKET GTTPAEGSKM  180
LKGVDVEDAL MLVPSARCQQ AVPFSKIAQF PGMQAVLDNV MSAKRIHLID LGIQSGLPFP  240
IIMNALANRN ECPVELLKIT AVGTSRQRIE ETGKMLSSFA EQMNIPFLFS MVVLELKDLR  300
KENIELEEGE VVAVYSEFRL WTMLAWPNHL EGLVRVINSL KPSVMVVSEV EASTNTPSFM  360
NRFDALLSYC SATFDCLGTC MKPDDKNRAI AEGIFLREMI QSVIIVEGED RIQHARISFW  420
REYFARFGIV ETEFSASSLY QADLLIQSTA CWKSCSWEFD GKCLITKWKG TPVNSLSAWK  480
FPHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3213148020375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019174204.11e-146PREDICTED: scarecrow-like protein 23
STRINGSolyc01g059960.1.11e-129(Solanum lycopersicum)
STRINGPGSC0003DMT4000562321e-129(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-44RGA-like 1