PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00218g00178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family SAP
Protein Properties Length: 453aa    MW: 50558.8 Da    PI: 6.1375
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00218g00178.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP736.32.6e-22414521454
                       SAP   1 mssssssssseseegseggeggdassgesegpsssrqr..aanevwpePflealatqvaidasrslGrlaaasalanvfqvcstw 83 
                               msssss  ss    g  gg g  + sge+egpsssr+r  a n+vwpePfle la  va+dasrs+Grl aa+ala vfqvcstw
  Peaxi162Scf00218g00178.1   1 MSSSSSPPSS--LGGVGGGDG-SHVSGEFEGPSSSRSRirAENDVWPEPFLEDLALIVATDASRSIGRLGAAQALALVFQVCSTW 82 
                               5555554444..444434444.55568999999888766699******************************************* PP

                       SAP  84 ravsrsdllwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadv.dedndadalsCrclalsdkylaaGf 167
                               +avs sdllwq+ltrriW+r +llr+tWreeyiy+h++a+nfr+ ry+y tl+f p ++ d++n++d l Cr+lalsd++laaGf
  Peaxi162Scf00218g00178.1  83 QAVSHSDLLWQNLTRRIWNRHHLLRQTWREEYIYWHQAANNFRHHRYAYNTLHFVPENNeDNNNNNDGLFCRRLALSDHHLAAGF 167
                               *******************************************************9876155677899***************** PP

                       SAP 168 adGavrlfdletrlhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaG 252
                               adG+v+lf l trlh+stf+p+h+drlGrfsravsGi+++d +lvfa+ldGdihv vi    aa++rra+lGdvvndGalvdf+G
  Peaxi162Scf00218g00178.1 168 ADGSVQLFYLPTRLHLSTFHPHHHDRLGRFSRAVSGIILTDVQLVFASLDGDIHVVVIGD--AAPPRRAHLGDVVNDGALVDFTG 250
                               **********************************************************98..78********************* PP

                       SAP 253 sgrWwvGlyaGvpGrafhiWdaeteelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlr 337
                               +++WwvGlyaGvpGrafhiW+ eteelvfvGG ltdPea+mGWhmlte+telvGrvrvt retavaCtsl+++v+dl+nqg+++r
  Peaxi162Scf00218g00178.1 251 CDQWWVGLYAGVPGRAFHIWNRETEELVFVGGELTDPEALMGWHMLTEVTELVGRVRVTTRETAVACTSLQVMVIDLQNQGIIIR 335
                               ************************************************************************************* PP

                       SAP 338 eeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyaggvlrvWeiekkegylysl 421
                                + +rrGliv+s+d+ ne++v+vdsrGva+vrrv++lee+crf+vrg  q gvlgC+nggya+++ g v+rvWeie+ + ylys+
  Peaxi162Scf00218g00178.1 336 AQPFRRGLIVASFDVRNETLVTVDSRGVASVRRVDDLEEICRFNVRGaNQMGVLGCMNGGYAIMWLGNVIRVWEIEHGA-YLYSI 419
                               ***********************************************999***************************77.***** PP

                       SAP 422 rervgevnalvaddrhvavsssdgtihlldfga 454
                               rer+g+vna+vad+r++a++ssd+tihl+dfga
  Peaxi162Scf00218g00178.1 420 RERIGDVNAIVADERYLAACSSDSTIHLWDFGA 452
                               ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.501.6E-669131No hitNo description
SuperFamilySSF813832.62E-770157IPR001810F-box domain
Gene3DG3DSA:2.130.10.102.2E-13132226IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509982.35E-14137282IPR011047Quinoprotein alcohol dehydrogenase-like superfamily
Gene3DG3DSA:2.130.10.102.2E-13274450IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509982.35E-14322450IPR011047Quinoprotein alcohol dehydrogenase-like superfamily
PROSITE profilePS5029410.258405453IPR017986WD40-repeat-containing domain
PROSITE profilePS500829.071432453IPR001680WD40 repeat
PROSITE patternPS006780436450IPR019775WD40 repeat, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSSSSSPPSS LGGVGGGDGS HVSGEFEGPS SSRSRIRAEN DVWPEPFLED LALIVATDAS  60
RSIGRLGAAQ ALALVFQVCS TWQAVSHSDL LWQNLTRRIW NRHHLLRQTW REEYIYWHQA  120
ANNFRHHRYA YNTLHFVPEN NEDNNNNNDG LFCRRLALSD HHLAAGFADG SVQLFYLPTR  180
LHLSTFHPHH HDRLGRFSRA VSGIILTDVQ LVFASLDGDI HVVVIGDAAP PRRAHLGDVV  240
NDGALVDFTG CDQWWVGLYA GVPGRAFHIW NRETEELVFV GGELTDPEAL MGWHMLTEVT  300
ELVGRVRVTT RETAVACTSL QVMVIDLQNQ GIIIRAQPFR RGLIVASFDV RNETLVTVDS  360
RGVASVRRVD DLEEICRFNV RGANQMGVLG CMNGGYAIMW LGNVIRVWEI EHGAYLYSIR  420
ERIGDVNAIV ADERYLAACS SDSTIHLWDF GAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596786.10.0PREDICTED: transcriptional regulator STERILE APETALA-like
RefseqXP_016468216.10.0PREDICTED: transcriptional regulator STERILE APETALA-like
SwissprotQ9FKH11e-172SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLK4C0A30.0K4C0A3_SOLLC; Uncharacterized protein
STRINGSolyc05g041220.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40992345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-170SAP family protein