PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00208g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 177aa    MW: 19355 Da    PI: 5.7301
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00208g00014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1711.3e-5324116193
                     NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                               +reqdr+lPian++rimkk lP+n+ki+kd+k+tvqecvsefisf+tseasdkcqrekrktingddll+alatlGfedy+eplk+
  Peaxi162Scf00208g00014.1  24 MREQDRYLPIANIGRIMKKGLPSNGKIAKDSKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLHALATLGFEDYIEPLKI 108
                               59*********************************************************************************** PP

                     NF-YB  86 ylkkyrel 93 
                               yl++yre+
  Peaxi162Scf00208g00014.1 109 YLTRYREV 116
                               ******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.0E-4921116IPR009072Histone-fold
SuperFamilySSF471134.04E-3727117IPR009072Histone-fold
PfamPF008081.3E-263094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.6E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.6E-207795No hitNo description
PRINTSPR006154.6E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAEAASPGGG GGHEESGGSP QCSMREQDRY LPIANIGRIM KKGLPSNGKI AKDSKDTVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LHALATLGFE DYIEPLKIYL TRYREVIMIQ  120
LHVFNVMVLR LGDAKGSAMV GDASVRKDIV GNQLGPNMQF VYEGSFAQGL DYGNSQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4724115192Transcription factor HapC (Eurofung)
4g92_B3e-4724115192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604648.11e-88PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_009782060.11e-88PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_016476361.11e-88PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_018627362.11e-88PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_019264327.11e-88PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ8VYK41e-65NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A1S4AI783e-87A0A1S4AI78_TOBAC; nuclear transcription factor Y subunit B-10-like
TrEMBLA0A1U7X6G33e-87A0A1U7X6G3_NICSY; nuclear transcription factor Y subunit B-10-like
TrEMBLA0A314L5Z43e-87A0A314L5Z4_NICAT; Nuclear transcription factor y subunit b-10
STRINGXP_009782060.14e-88(Nicotiana sylvestris)
STRINGXP_009604648.15e-88(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.13e-65nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]