PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00188g00066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family bZIP
Protein Properties Length: 202aa    MW: 23424.2 Da    PI: 6.0862
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00188g00066.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.63.7e-1587145563
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                               +r rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l+++++  +++ +e+
  Peaxi162Scf00188g00066.1  87 RRKRRMISNRESARRSRMRKQRHLDELWSQVLRLRTENHTLIDKLNQISESHERVLQEN 145
                               799***********************************************999998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-1683147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.26685148IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1187159No hitNo description
SuperFamilySSF579591.69E-1287137No hitNo description
PfamPF001706.3E-1387145IPR004827Basic-leucine zipper domain
CDDcd147025.14E-2088138No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MIPSEAAATH YFATENPSPL PLDFNFMQNM SSPTFQFSRY LTNLQNYPTS LAVHHDFNNN  60
LPLPSCISSN STSDEADEQQ LRVIDERRKR RMISNRESAR RSRMRKQRHL DELWSQVLRL  120
RTENHTLIDK LNQISESHER VLQENVQLKE EATDLRQMLT DIQLINSPFP DFSDLEEVPC  180
TTAHLKAESS NLSITTSTNL LH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199106RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016553291.11e-112PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC25e-40BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A1U8F3T31e-110A0A1U8F3T3_CAPAN; basic leucine zipper 43-like
TrEMBLA0A2G2VKG61e-110A0A2G2VKG6_CAPBA; Basic leucine zipper 43
TrEMBLA0A2G3B6R01e-110A0A2G3B6R0_CAPCH; Basic leucine zipper 43
STRINGXP_009774323.11e-111(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-47basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]