PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00139g00134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 226aa    MW: 25429.2 Da    PI: 6.7889
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00139g00134.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB135.22e-4235130297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               reqd +lPianv+rim+++lP++ak+s+dake vqe vs+fi  +t  a+++c++e+r+t++++d +wa+ ++G+ +yvepl++y
  Peaxi162Scf00139g00134.1  35 REQDLYLPIANVTRIMRRILPQHAKVSDDAKEAVQELVSQFINHITIIANERCHKEQRRTVTAEDCIWAMNKIGLTNYVEPLTLY 119
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l++yre e+++
  Peaxi162Scf00139g00134.1 120 LQRYREQESDR 130
                               ********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.2E-4331138IPR009072Histone-fold
SuperFamilySSF471133.26E-3337136IPR009072Histone-fold
PfamPF008083.1E-2040104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.2E-96886No hitNo description
PRINTSPR006156.2E-987105No hitNo description
PRINTSPR006156.2E-9106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MDCGHISNQQ RRNASSNYGS NNNGSGTLPN QQARREQDLY LPIANVTRIM RRILPQHAKV  60
SDDAKEAVQE LVSQFINHIT IIANERCHKE QRRTVTAEDC IWAMNKIGLT NYVEPLTLYL  120
QRYREQESDR SSGQRRPVHM SPNVELGLAP PTGSVQAFPL NYAPAQGYPY PQFHSFYDPA  180
VMMNGFNMNY GNEGMAENDE PAESSSSTGT NYGLPGVNDP FGQFRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-4235125797NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018622700.11e-104PREDICTED: nuclear transcription factor Y subunit B-2-like
TrEMBLA0A1U7WXA53e-96A0A1U7WXA5_NICSY; nuclear transcription factor Y subunit B-6-like
STRINGXP_009784547.15e-97(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1624655
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-46nuclear factor Y, subunit B6