PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00123g01721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TCP
Protein Properties Length: 208aa    MW: 22356.5 Da    PI: 8.8946
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00123g01721.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP111.41.3e-3454121673
                       TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                               ++++++hTkv+gR+RRvR++a+caar+F+L++eLG+ +d++tieWLl+ a+pai+++tgt++ +a+ +
  Peaxi162Scf00123g01721.1  54 SSTKDRHTKVNGRGRRVRMPALCAARVFQLTKELGHRTDGETIEWLLRHAEPAIIAATGTGTVPATTV 121
                               689*********************************************************98888555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.1E-3055123IPR005333Transcription factor, TCP
PROSITE profilePS5136927.2156110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGSEMVLHHH QFSNTNQPHD NEVALMAGNM TTNDKKALMV VSKKRNNSSL SVSSSTKDRH  60
TKVNGRGRRV RMPALCAARV FQLTKELGHR TDGETIEWLL RHAEPAIIAA TGTGTVPATT  120
VLTTAEGIKS PPSVLAPVSR STAVSGFPMG GCGVFPMTGN PSCRLDLEFS NGYRHMPFTA  180
LLLQPVNSTA ADDGGEEKPL VIDFVPSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019251615.18e-79PREDICTED: transcription factor TCP11
SwissprotQ9SJK72e-36TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A1J6IUH02e-77A0A1J6IUH0_NICAT; Transcription factor tcp11
STRINGXP_009794398.12e-76(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.14e-29TCP family protein