PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00119g00126.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 198aa    MW: 21638.2 Da    PI: 4.2497
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00119g00126.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB73.82.7e-231196388
                     NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
                              ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+r+ti+++ +l al  lGf +y+ ++     
  Peaxi162Scf00119g00126.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREERRTIAPEHVLKALEVLGFGEYIGEVYSAYD 96
                              6899**************************************************************************88765544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-378139IPR009072Histone-fold
SuperFamilySSF471131.84E-3412141IPR009072Histone-fold
PfamPF008089.9E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEPMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDTQ DLLIECCVEF INLISSESNE  60
VCNREERRTI APEHVLKALE VLGFGEYIGE VYSAYDQHRL ETMDTGRAVK CSNGAAMTEE  120
EALAEQQRMF AEARARMNGG VTAPSKQPDL GTEQNLMNGG DAAPSKQPDS ETTQSLMNGG  180
VTAPANQPDS EMDQNLNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-341213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-33HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755182e-33HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464437.11e-113PREDICTED: protein Dr1 homolog
RefseqXP_016464438.11e-113PREDICTED: protein Dr1 homolog
SwissprotP495923e-87NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A1S3ZJQ01e-111A0A1S3ZJQ0_TOBAC; protein Dr1 homolog
STRINGXP_009782371.11e-105(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-91nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]