PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00045g01824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CO-like
Protein Properties Length: 336aa    MW: 37525.1 Da    PI: 6.0081
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00045g01824.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.81.8e-07344439
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              r+C+ ++   ++ fC+ +  +lC  C +++H        H +
  Peaxi162Scf00045g01824.1  3 RRCDSCKTTSATVFCKADMAFLCLGCDSKIHAAnklasrHAR 44
                              79******99*********************65566666655 PP

2zf-B_box254e-084690442
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               +C+ +e+ +++  C+ +   lC +C + +H+       H++ p+
  Peaxi162Scf00045g01824.1 46 LVCEVCEHAPASVTCKADAAALCVTCDQDIHSAnplarrHERLPI 90
                              68*****************************66888888998876 PP

3CCT69.86.7e-24273317145
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Peaxi162Scf00045g01824.1 273 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRNE 317
                               9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.911147IPR000315B-box-type zinc finger
SMARTSM003369.0E-10147IPR000315B-box-type zinc finger
PfamPF006432.0E-5344IPR000315B-box-type zinc finger
CDDcd000214.30E-6347No hitNo description
PROSITE profilePS5011911.2344390IPR000315B-box-type zinc finger
PfamPF006432.5E-64690IPR000315B-box-type zinc finger
CDDcd000213.69E-84790No hitNo description
SMARTSM003367.9E-114890IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787273315IPR010402CCT domain
PfamPF062034.8E-18273315IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MARRCDSCKT TSATVFCKAD MAFLCLGCDS KIHAANKLAS RHARVLVCEV CEHAPASVTC  60
KADAAALCVT CDQDIHSANP LARRHERLPI VPFYDSASAK SRAADETQLP ETEEEAEAES  120
WLLQAPNINI NNNNIGVEGN EYNKSAEYLF SDVDPYVDME MITDQKPCTD IQLHQEYKEA  180
DCVVPHVQNK NNEMIHLQGP VVDGYPTYHE MDFTGSKPFM YNFSTQSISQ SVSSSSMEVG  240
VVPDHNSMAD VSNTFVRNSS TDGLPTPVSS LDREARVLRY REKRKNRKFE KTIRYASRKA  300
YAETRPRIKG RFAKRNEIEV DSLIASDASY GVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604722.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016495106.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2
SwissprotQ940T95e-95COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4C1S70.0A0A1S4C1S7_TOBAC; zinc finger protein CONSTANS-LIKE 4-like isoform X2
STRINGXP_009604722.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.18e-93CONSTANS-like 4