PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00038g00217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 567aa    MW: 63944.6 Da    PI: 6.3686
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00038g00217.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2509.4e-771815612374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalklf 84 
                               ++lL  cA a++ g+++++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++  +s+ ++a+ ++++ +++n++   ++l  f
  Peaxi162Scf00038g00217.1 181 EHLLNPCAAAITVGNMNRVQHLLYVLQELASFTGDANHRLAAHGLRALTHHLSSpGSSSASSAFvEVTTFASNNHKFFRNSLINF 265
                               699***************************************************644455555547788888888888888888* PP

                      GRAS  85 sevsPilkfshltaNqaIleavegeerv...HiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........ske 156
                               ++ sP++++ + +aN+ +l+ + +++rv   Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T++ +  ++            
  Peaxi162Scf00038g00217.1 266 NDNSPWFRIPNHIANSSVLQILGEQDRVrnlHILDIGVSHGVQWPTLLEELTRRSgGPPPLVRLTVITPTIENgelrdtpfvIGP 350
                               *************************888888************************55666********97666788888777777 PP

                      GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                  +  ++L  fA+++++++++n l    l +l+ + ++ +++E+l+++ +++lh+l    +s ++ r+e+L+++ksl+Pk vv+
  Peaxi162Scf00038g00217.1 351 PGYNFSSQLLAFAKAININLQINRLDNFPLRNLNSQVINSSTDETLVICAQFRLHNLQ---HSNSDDRTELLRILKSLEPKGVVL 432
                               788999******************8777*****************************8...56666689**************** PP

                      GRAS 242 veqeadh..ns.esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                               +e+++++  ns ++F++ f++ +ey ++++ds+++ +    + r + Er++++ e+ +++++ g++    +e++ekW er++++G
  Peaxi162Scf00038g00217.1 433 SENNMECscNScGDFMTTFSRRVEYLWMFLDSTSVAY----KGRESEERRMMEGEAAKALTNMGEM----NERKEKWCERMRSVG 509
                               ***97764354259*******************9885....7777888888888899*******99....88888********** PP

                      GRAS 324 Fkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               F +  ++e+  + a++llrk++ ++++rvee++g++ l Wk++p+ ++S W+
  Peaxi162Scf00038g00217.1 510 FVKEVFGEDGIDGARALLRKYDnNWEMRVEERDGCVDLWWKGQPISFCSLWK 561
                               **********************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.852154540IPR005202Transcription factor GRAS
PfamPF035143.2E-74181561IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MIKHQNILSH HPSSWFSDTM TIGEPEPIST SDPISEWLGT LSDVPSFLDE PYYPEDLDFY  60
GDSWWDPNQD KQIVNQNIIN NTCTSFDSSS PANTATSTIP PEPIILDHLQ PLDQSKKRKT  120
PGSDQNSKTT RKNQNRQMND GDDGHAVVEQ GATIKRSTGP KRVTNKSSGN NSNNKEGRWA  180
EHLLNPCAAA ITVGNMNRVQ HLLYVLQELA SFTGDANHRL AAHGLRALTH HLSSPGSSSA  240
SSAFVEVTTF ASNNHKFFRN SLINFNDNSP WFRIPNHIAN SSVLQILGEQ DRVRNLHILD  300
IGVSHGVQWP TLLEELTRRS GGPPPLVRLT VITPTIENGE LRDTPFVIGP PGYNFSSQLL  360
AFAKAININL QINRLDNFPL RNLNSQVINS STDETLVICA QFRLHNLQHS NSDDRTELLR  420
ILKSLEPKGV VLSENNMECS CNSCGDFMTT FSRRVEYLWM FLDSTSVAYK GRESEERRMM  480
EGEAAKALTN MGEMNERKEK WCERMRSVGF VKEVFGEDGI DGARALLRKY DNNWEMRVEE  540
RDGCVDLWWK GQPISFCSLW KIDPKCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3117756184473Protein SHORT-ROOT
5b3h_B2e-3117756130419Protein SHORT-ROOT
5b3h_E2e-3117756130419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600029.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
RefseqXP_016460867.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A1S3Z9H40.0A0A1S3Z9H4_TOBAC; nodulation-signaling pathway 1 protein-like
STRINGXP_009600029.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-146GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]