PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00037g00085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 140aa    MW: 15902.7 Da    PI: 4.5591
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00037g00085.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB149.75.9e-47699497
                     NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                               ++++P+anv+rimk++lP  akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf+ y+e++  yl k 
  Peaxi162Scf00037g00085.1  6 VNKLVPVANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDSYAEAMIRYLYKL 92
                              5899*********************************************************************************** PP

                     NF-YB 91 relegek 97
                              re+e+++
  Peaxi162Scf00037g00085.1 93 REFERQR 99
                              ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.42E-369122IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.6E-459125IPR009072Histone-fold
PfamPF008081.1E-251073IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-163755No hitNo description
PROSITE patternPS0068504056IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-165674No hitNo description
PRINTSPR006152.2E-167593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MVDEHVNKLV PVANVGRIMK QILPPTAKIS KEAKETMQEC ASEFISFVTG EASDKCHKEN  60
RRTVNGDDIC WALSSLGFDS YAEAMIRYLY KLREFERQRA NQSKGSFNDD EDTDDEATSE  120
SEKQETTLSP PAPLEYFNLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-36794592Transcription factor HapC (Eurofung)
4g92_B2e-36794592Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019233101.16e-79PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040278e-51NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A2G2W7T31e-78A0A2G2W7T3_CAPBA; Nuclear transcription factor Y subunit B-4
STRINGXP_009760265.15e-76(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-52nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]