PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00017g03040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 157aa    MW: 17637.1 Da    PI: 4.546
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00017g03040.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB76.34.7e-241199391
                     NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
                              ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ +  ++
  Peaxi162Scf00017g03040.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALEVLGFGEYIEEVYAAYEH 97
                              6899***************************************************************************98765555 PP

                     NF-YB 90 yr 91
                              +r
  Peaxi162Scf00017g03040.1 98 HR 99
                              55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.5E-388138IPR009072Histone-fold
SuperFamilySSF471138.22E-3412139IPR009072Histone-fold
PfamPF008089.5E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MDPMDIVGKT KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
VCNREDKRTI APEHVLKALE VLGFGEYIEE VYAAYEHHRL ETVDTVRAGK CNNVAEMTEE  120
EALAAQQRMF AEARARMNGV AIVPPKQQDS RAEQMNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B9e-341213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754428e-39HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755158e-39HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617993.11e-104PREDICTED: protein Dr1 homolog
RefseqXP_016488041.11e-104PREDICTED: protein Dr1 homolog
SwissprotP495926e-86NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A1S4BGR21e-103A0A1S4BGR2_TOBAC; protein Dr1 homolog
STRINGXP_009617993.11e-104(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.44e-90nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]