PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00013g00829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NF-YB
Protein Properties Length: 392aa    MW: 43195.4 Da    PI: 4.5028
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00013g00829.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB39.91e-1230763884
                     NF-YB 38 cvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
                              c +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ 
  Peaxi162Scf00013g00829.1 30 CCAEFINLISSESNEVCNREDKRTIAPEHVLKALEVLGFGEYIEEVY 76
                              899****************************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.86E-2226125IPR009072Histone-fold
PfamPF008081.8E-82763IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.1E-2329122IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MLPPDVRVAR DTQDLLIDCC VAKCFLLLLC CAEFINLISS ESNEVCNRED KRTIAPEHVL  60
KALEVLGFGE YIEEVYGAYE QHKLETMDTG RAGKSTNAAE MTEEEALAEQ QRMFAEARAR  120
MNGGVTVPPK QQDSESEQQR MLAEARARMN GGVTVPPKQQ VSESEQQRMF AEAHARMNGG  180
VTVPPKQQDS DAEQQRMFAE AHASTNVGVP VPQQDALAEQ QRMFAEACAR MNGGVTVPPK  240
QQDALAEQQR LFAEACARMN DGVTIPPNQQ DALAEQQRMF AEAFARMNGG VTVPPKQQDA  300
LAEQQRMFAE ACARMNGDVT VPPKQQDALA EQQRLFAEAF ARMNGSVTVT PKQQDSEAEQ  360
QRMFAEASAK MNGGVTVPPK QQDSEAEQNL NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B4e-25411830133Transcription Regulator NC2 beta chain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754459e-47HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755189e-47HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016471364.11e-141PREDICTED: protein Dr1 homolog
TrEMBLA0A1S4A4471e-139A0A1S4A447_TOBAC; protein Dr1 homolog
STRINGXP_009792100.11e-117(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2489822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.41e-58nuclear factor Y, subunit B13