PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00011g00820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 159aa    MW: 17764.2 Da    PI: 9.5016
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00011g00820.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer62.58.7e-202072558
               ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                               Y eC++N  +   ++a+DGC+ f p     gt++al+C  CgCH nFHRr ++
  Peaxi162Scf00011g00820.1 20 LYGECMRNRSVGSMTYATDGCQGFAPG-YPLGTIEALRCQTCGCHQNFHRRLET 72
                              6*************************8.4559******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-172070IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-152169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-92169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.7532170IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MLRIRANKTW VNRRSRSLPL YGECMRNRSV GSMTYATDGC QGFAPGYPLG TIEALRCQTC  60
GCHQNFHRRL ETRHPQQQVY DGTRIGYSPP STIIPLPLPP PSTQPDAPPT TNLTMEESNT  120
NANSSSYSLR VGATVELGFD MNKYRLAPTF SIPLFPLKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1533648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-13mini zinc finger 1