PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00011g00739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 282aa    MW: 31274.2 Da    PI: 10.2188
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00011g00739.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer60.73.2e-191769558
               ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                               Y eC++N+ a+  ++a+DGC  f p  g  g++ a++C  CgCHRnFHRr  +
  Peaxi162Scf00011g00739.1 17 LYGECMRNQLADSMTYATDGCHGFGPG-GPPGSIGAMRCQTCGCHRNFHRRLDT 69
                              7*************************8.888*******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-41269IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-171766IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-141866IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.7011867IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MFRANKPWAN GSITPALYGE CMRNQLADSM TYATDGCHGF GPGGPPGSIG AMRCQTCGCH  60
RNFHRRLDTG NHQIPPPSHP RRQIYGGTRL GYYPPTIILL QPPPPATRPN APPPTNLTMG  120
EANTNANSLT HSFRVSTGLE NISSTSLNLP CVHPPFTCTG GSTKGKEKMD ERTLRRLASN  180
KSPLPPLPQS APLGVYHRRG RDLIRARIAA KINNGEGSSR KRNFYSRGYY LREEMRERVR  240
LLSKQLEWLN VKNKLKGKNL KHESSSDKNE SDDDESHSDS DS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1533648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-07mini zinc finger 1